Protein Info for PGA1_c11300 in Phaeobacter inhibens DSM 17395

Annotation: putative nodulation protein L

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 PF12464: Mac" amino acids 8 to 57 (50 residues), 31.8 bits, see alignment E=2.1e-11 PF14602: Hexapep_2" amino acids 131 to 166 (36 residues), 31.8 bits, see alignment 1.4e-11 PF00132: Hexapep" amino acids 132 to 166 (35 residues), 39.7 bits, see alignment 3.7e-14

Best Hits

Swiss-Prot: 42% identical to YJV8_YEAST: Putative acetyltransferase YJL218W (YJL218W) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

KEGG orthology group: K00661, maltose O-acetyltransferase [EC: 2.3.1.79] (inferred from 68% identity to ret:RHE_CH00246)

Predicted SEED Role

"Maltose O-acetyltransferase (EC 2.3.1.79)" in subsystem Maltose and Maltodextrin Utilization (EC 2.3.1.79)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.79

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DZH9 at UniProt or InterPro

Protein Sequence (184 amino acids)

>PGA1_c11300 putative nodulation protein L (Phaeobacter inhibens DSM 17395)
MSQTERQKMQAGDWYCCIDSELSVLRHQARLAVHQHNHRAPDPSETLSPPLAALFAEHGQ
NCLIETPFHCAYGINITLGHQVYMNAGCTILDSAPVRIGDRSMLGPNVQIYCAQHHKDKA
LRAEGLEIAYPVTLGSDVWIGGGVIILPGVSIGDGAIVGAGAVVTRDVEAGVTVVGNPAR
ALPR