Protein Info for Psest_1144 in Pseudomonas stutzeri RCH2

Annotation: AmpG-related permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 566 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 52 to 69 (18 residues), see Phobius details amino acids 90 to 107 (18 residues), see Phobius details amino acids 114 to 135 (22 residues), see Phobius details amino acids 156 to 177 (22 residues), see Phobius details amino acids 190 to 210 (21 residues), see Phobius details amino acids 232 to 254 (23 residues), see Phobius details amino acids 260 to 279 (20 residues), see Phobius details amino acids 300 to 322 (23 residues), see Phobius details amino acids 333 to 355 (23 residues), see Phobius details amino acids 370 to 394 (25 residues), see Phobius details amino acids 409 to 428 (20 residues), see Phobius details amino acids 435 to 454 (20 residues), see Phobius details amino acids 460 to 486 (27 residues), see Phobius details amino acids 498 to 517 (20 residues), see Phobius details amino acids 525 to 545 (21 residues), see Phobius details PF13000: Acatn" amino acids 21 to 170 (150 residues), 28.5 bits, see alignment E=6.2e-11 PF07690: MFS_1" amino acids 21 to 355 (335 residues), 41.3 bits, see alignment E=9.6e-15 TIGR00901: AmpG-like permease" amino acids 29 to 507 (479 residues), 441.7 bits, see alignment E=1.2e-136

Best Hits

KEGG orthology group: K08218, MFS transporter, PAT family, beta-lactamase induction signal transducer AmpG (inferred from 96% identity to psa:PST_3151)

Predicted SEED Role

"AmpG permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GG38 at UniProt or InterPro

Protein Sequence (566 amino acids)

>Psest_1144 AmpG-related permease (Pseudomonas stutzeri RCH2)
MSRETWRDALAAYASPATLALLLLGFAAGLPAVLVFSTLSVWLREAGVSRETIGFASWIS
LAYAFKWVWSPMLDQWRLPWIGSLGRRRSWLVLSQALIAIGLIGMALCNPQHNLTMLIAL
AVVVAFSSATQDIAIDAYRLEIAEDKLQATLAASYMTGYRIAMLLASAGALFLAEWLGSS
SLDYNQAAWTTTYLVFALLIVPGLITSLVIREPDAGIPLPNEPSRFSFNHQLAAVGLLLV
LLISVPAMINALIAQAWPRATLYALFILGTISPVGRALFVPVRHIFSQAKERQRPTRFDF
AHQAVSVIVLIILMVSTTGMFQSYWGGYWPRGTMYLLICWGCLSAPGRILMGPVLTPITD
FIVRYRWQALLLLGLIATYRMSDTVMGVMANVFYIDQGFSKDEIASVSKLFGLVMTLLGA
AFGGLLIVRFSILPILFIGGVASAATNLMFMLLVEMGANLQMLIVTISCDNFSGGLASTA
FVAYLSSLTNLKFSATQYALLSSLMLLLPRLLGGYSGVMVESLGYSNFFLVTALLGIPTL
VLIAWQWTRSRGQPDDGVREGVSERS