Protein Info for Psest_1143 in Pseudomonas stutzeri RCH2

Annotation: Small-conductance mechanosensitive channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 60 to 85 (26 residues), see Phobius details amino acids 91 to 121 (31 residues), see Phobius details PF21088: MS_channel_1st" amino acids 69 to 107 (39 residues), 24.1 bits, see alignment 4.3e-09 PF00924: MS_channel_2nd" amino acids 109 to 175 (67 residues), 73.9 bits, see alignment E=1.3e-24 PF21082: MS_channel_3rd" amino acids 182 to 262 (81 residues), 57.8 bits, see alignment E=1.8e-19

Best Hits

Swiss-Prot: 43% identical to MSCS_EDWI9: Small-conductance mechanosensitive channel (mscS) from Edwardsiella ictaluri (strain 93-146)

KEGG orthology group: K03442, small conductance mechanosensitive channel (inferred from 98% identity to psa:PST_3152)

MetaCyc: 40% identical to small conductance mechanosensitive channel MscS (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-86

Predicted SEED Role

"Small-conductance mechanosensitive channel"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GIU6 at UniProt or InterPro

Protein Sequence (274 amino acids)

>Psest_1143 Small-conductance mechanosensitive channel (Pseudomonas stutzeri RCH2)
MDLSVDYLVDLSESWLPVVLQYGAQVTLALLTFLFGWWLINTLTAKVSSLLQRRQVDPTL
HGFIGSLASVVLKVLLLVSVASMIGVETTSFIAVIGAAGLAIGLALQGSLANFAGGVLIL
LFRPFRVGEWIEAQGIAGTVNSIQIFHTVLKTGDNKTVVVPNGALSNGHITNFSREPRRR
ADINIGIDYSSDIKLARQVLLEIAEDPRVLREPEPVVFVTGLGDSSVNLSLRVWVATADF
WPVTFSFTEQAKERLTAVGVGIPFPQRVVHLVQR