Protein Info for Psest_1141 in Pseudomonas stutzeri RCH2

Annotation: diguanylate cyclase (GGDEF) domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 PF00072: Response_reg" amino acids 8 to 122 (115 residues), 72 bits, see alignment E=4.5e-24 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 149 to 287 (139 residues), 38.4 bits, see alignment E=5.1e-14 PF00990: GGDEF" amino acids 154 to 303 (150 residues), 51.5 bits, see alignment E=1e-17

Best Hits

KEGG orthology group: None (inferred from 87% identity to psa:PST_3154)

Predicted SEED Role

"COG3706: Response regulator containing a CheY-like receiver domain and a GGDEF domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJX2 at UniProt or InterPro

Protein Sequence (321 amino acids)

>Psest_1141 diguanylate cyclase (GGDEF) domain (Pseudomonas stutzeri RCH2)
MPNPLLSILVVDDAKFSSVMIGRALSKAGYQDIRFASSAADALMQHAQRPAHVLLADWLM
PEMDGLELTGQIRQRDALSGHYSYVILLTGRDSENALGQAFDHGVDDFISKSAMNEQLLP
RIFAADRLCGSLQRLKQENHQLTENVATLEQHSLQDPLTGLGNGRYLQQRMAASLRQMEN
RGSALYYLQIGLAEADALRERYGEAVYAEILCAIAIRLQQLVRPLDIVCRISESQFGLLA
LVNDAKGCSPSSFKRLHEGLNLRALKTSEGFVSIKAGISLVSLDSEALPIAPETVIERAA
ALLPSAYSTGRIVPLRLKQPA