Protein Info for Psest_1140 in Pseudomonas stutzeri RCH2

Annotation: 2-dehydropantoate 2-reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF02558: ApbA" amino acids 3 to 151 (149 residues), 119.2 bits, see alignment E=1.2e-38 TIGR00745: 2-dehydropantoate 2-reductase" amino acids 3 to 293 (291 residues), 252.9 bits, see alignment E=2.1e-79 PF08546: ApbA_C" amino acids 174 to 293 (120 residues), 110.8 bits, see alignment E=5.8e-36

Best Hits

Swiss-Prot: 65% identical to PANE_PSEAE: Probable 2-dehydropantoate 2-reductase (panE) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00077, 2-dehydropantoate 2-reductase [EC: 1.1.1.169] (inferred from 78% identity to psa:PST_3155)

Predicted SEED Role

"2-dehydropantoate 2-reductase (EC 1.1.1.169)" in subsystem Coenzyme A Biosynthesis (EC 1.1.1.169)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.169

Use Curated BLAST to search for 1.1.1.169

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GK59 at UniProt or InterPro

Protein Sequence (303 amino acids)

>Psest_1140 2-dehydropantoate 2-reductase (Pseudomonas stutzeri RCH2)
MSWHVLGAGALGSLWATRLHRAGMPVRIILRSAQRLADYQRAGGLTLSEAGHSSLHAIPA
ELPDATTPIQRLLVACKAYDAEAAIAKLAPRLAPDCEMLLLQNGLGSQQAIAARWPQARC
IFVSSTEGAYRDGPMHVVFAGHGQNWLGDPNGGNAPVWLEELDRAGIPYNWSSDILARLW
RKLALNCAINPLTVLYDCRNGELLQYREQLSEICEELIELLSACGQAPAAEDLQREVLRV
IEATAANYSSMYQDVRLGRRTEIAYLLGHACRSADSLGLAVPRLHALHQRLREHLSQRGL
PTD