Protein Info for Psest_1136 in Pseudomonas stutzeri RCH2

Annotation: Prolyl oligopeptidase family.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 PF01738: DLH" amino acids 22 to 228 (207 residues), 22.2 bits, see alignment E=3.7e-08 PF12697: Abhydrolase_6" amino acids 31 to 190 (160 residues), 36.3 bits, see alignment E=3.9e-12 PF12146: Hydrolase_4" amino acids 31 to 141 (111 residues), 31 bits, see alignment E=6.5e-11 PF00561: Abhydrolase_1" amino acids 31 to 139 (109 residues), 33.1 bits, see alignment E=1.9e-11 PF00326: Peptidase_S9" amino acids 53 to 239 (187 residues), 44.7 bits, see alignment E=4.8e-15 PF07859: Abhydrolase_3" amino acids 80 to 134 (55 residues), 25.8 bits, see alignment E=3.3e-09 PF05728: UPF0227" amino acids 96 to 221 (126 residues), 22.7 bits, see alignment E=3.2e-08

Best Hits

KEGG orthology group: K06889, (no description) (inferred from 94% identity to psa:PST_3159)

Predicted SEED Role

"Prolyl oligopeptidase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJW6 at UniProt or InterPro

Protein Sequence (263 amino acids)

>Psest_1136 Prolyl oligopeptidase family. (Pseudomonas stutzeri RCH2)
MATHSEMVNILVGEEHIAGTFLSPPEKMPGVLFVHGWGGSQQRDLSRARGIAGLGCVCLS
FDLRGHAQTRAQQETVTREQNLDDLLAAYDLLAQHPHIDPSAIAVVGTSYGGYLAAILTE
LRPVKWLALRVPALYLDDEWQVPKRQLDRDVLNQLRNRRVRPEENRALAACAAFRGDVLI
VESEHDTFVPHETIMSYRAAFHSTHSLTHRIIDGADHALSNERCQEGYTSILVNWATEMI
VGARLDEKSAMGFKNVEEGEATG