Protein Info for Psest_1133 in Pseudomonas stutzeri RCH2

Annotation: peroxiredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 187 TIGR03137: peroxiredoxin" amino acids 1 to 187 (187 residues), 318.3 bits, see alignment E=7.8e-100 PF00578: AhpC-TSA" amino acids 5 to 133 (129 residues), 110.4 bits, see alignment E=8.9e-36 PF08534: Redoxin" amino acids 22 to 147 (126 residues), 53.3 bits, see alignment E=4.2e-18 PF10417: 1-cysPrx_C" amino acids 154 to 182 (29 residues), 33 bits, see alignment 7e-12

Best Hits

Swiss-Prot: 96% identical to AHPC_PSEAB: Alkyl hydroperoxide reductase C (ahpC) from Pseudomonas aeruginosa (strain UCBPP-PA14)

KEGG orthology group: K03386, peroxiredoxin (alkyl hydroperoxide reductase subunit C) [EC: 1.11.1.15] (inferred from 100% identity to psa:PST_3162)

MetaCyc: 60% identical to alkyl hydroperoxide reductase, AhpC component (Escherichia coli K-12 substr. MG1655)
R4-RXN [EC: 1.11.1.26]

Predicted SEED Role

"Alkyl hydroperoxide reductase protein C (EC 1.6.4.-)" in subsystem Thioredoxin-disulfide reductase (EC 1.6.4.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.11.1.15, 1.6.4.-

Use Curated BLAST to search for 1.11.1.15 or 1.11.1.26 or 1.6.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GIT8 at UniProt or InterPro

Protein Sequence (187 amino acids)

>Psest_1133 peroxiredoxin (Pseudomonas stutzeri RCH2)
MSLINTQVQPFKVNAFHNGKFIEVTEESLKGKWSVLIFMPAAFTFNCPTEIEDAANSYAE
FQKAGTEVYIVTTDTHFSHKVWHETSPAVGKAQFPLIGDPTHQLTRAFGVHIEEEGLALR
GTFLINPEGVIKTVEIHSNEIARDVSETLRKLKAAQYTAAHPGEVCPAKWKEGEKTLAPS
LDLVGKI