Protein Info for Psest_0110 in Pseudomonas stutzeri RCH2

Annotation: malonate transporter, MadM subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 42 to 63 (22 residues), see Phobius details amino acids 70 to 96 (27 residues), see Phobius details amino acids 106 to 131 (26 residues), see Phobius details amino acids 137 to 159 (23 residues), see Phobius details amino acids 165 to 191 (27 residues), see Phobius details amino acids 198 to 218 (21 residues), see Phobius details amino acids 225 to 250 (26 residues), see Phobius details TIGR00808: malonate transporter, MadM subunit" amino acids 1 to 254 (254 residues), 373.9 bits, see alignment E=2.1e-116 PF03818: MadM" amino acids 5 to 252 (248 residues), 408.3 bits, see alignment E=5.9e-127

Best Hits

KEGG orthology group: None (inferred from 98% identity to psa:PST_4112)

Predicted SEED Role

"Malonate transporter, MadM subunit" in subsystem Malonate decarboxylase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GDB1 at UniProt or InterPro

Protein Sequence (254 amino acids)

>Psest_0110 malonate transporter, MadM subunit (Pseudomonas stutzeri RCH2)
MYESLMKVISGYGLISGFAIIGATMWISYWLSDKLTKGRLHGSAVAILIGLLLSYIGGVV
TGGQKGLVDIALFSGIGLLGGAMLRDFAIVATGFGVSVDELKRAGMVGVLALFIGVLASF
VAGVAVAFAFGYTDAVSLTTIGTGAVTYIVGPVTGAAIGASSEVMALSIAAGLVKAIVVM
VATPFVAPYIGLNNPRSAVIFGGLIGTSSGVAGGLAATDPKLVPYGCLTAAFYTALGCLL
GPSLLFFVMRGLLG