Protein Info for PGA1_c11140 in Phaeobacter inhibens DSM 17395

Annotation: arginyl-tRNA synthetase ArgS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 581 transmembrane" amino acids 556 to 575 (20 residues), see Phobius details PF03485: Arg_tRNA_synt_N" amino acids 7 to 94 (88 residues), 73 bits, see alignment E=7.8e-24 TIGR00456: arginine--tRNA ligase" amino acids 11 to 580 (570 residues), 352.6 bits, see alignment E=1.7e-109 PF00750: tRNA-synt_1d" amino acids 105 to 413 (309 residues), 64.5 bits, see alignment E=2.6e-21 PF05746: DALR_1" amino acids 451 to 580 (130 residues), 88.2 bits, see alignment E=1.3e-28

Best Hits

Swiss-Prot: 85% identical to SYR_RUEST: Arginine--tRNA ligase (argS) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K01887, arginyl-tRNA synthetase [EC: 6.1.1.19] (inferred from 85% identity to sit:TM1040_0903)

Predicted SEED Role

"Arginyl-tRNA synthetase (EC 6.1.1.19)" (EC 6.1.1.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EKU7 at UniProt or InterPro

Protein Sequence (581 amino acids)

>PGA1_c11140 arginyl-tRNA synthetase ArgS (Phaeobacter inhibens DSM 17395)
MNLFTDIRSLVLDCLTAMVDEGTLPEGLDFANVAVEPPRDAAHGDMATNAAMVLAKPAKM
KPRDIADALAGKLAADARVTSAEVAGPGFLNLRLDRSSWQSVLGAVLAEDIKFGRSDLGA
GKRVNVEYVSANPTGPLHVGHTRGAVFGDALASLLDFVGYDVTREYYINDGGGQVDVLAR
SVYLRYLEAHGQEVAFVDGTYPGDYLVPVGQALKDKVGDAYVNQPEDVWLEEIRNFATDA
MMDLIRADLASLGIQMDKFFSEKSLYGTGLIESALKSLDDKGLIYEGVLEPPKGKKPDDW
EPREQTLFKSTEHGDDVDRPVKKSDGAWTYFAPDIAYHYDKVERGFDMLIDIFGADHGGY
VKRMKAAVSALSDGRVPLDIKLCQLVKLFKDGQEFKMSKRAGTFVTLRDVVDAVGPDVTR
FMLLTRKNDQGFDFDLDKALEQSKDNPVFYVQYANARICSTLRKAAEAGITTDDATLAAA
DLTLLQDDAQLTVAKKLAEWPRLVEIAARTNEPHRVAFYLYDLASELHGLYHLGKTNEGL
RFVNESNPSATHAKMALAKAVSIVISAGLGILGVTPAQEMR