Protein Info for PGA1_c11100 in Phaeobacter inhibens DSM 17395

Annotation: Predicted membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 172 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 41 to 61 (21 residues), see Phobius details amino acids 67 to 85 (19 residues), see Phobius details PF04239: DUF421" amino acids 90 to 157 (68 residues), 55.7 bits, see alignment E=1.9e-19

Best Hits

KEGG orthology group: None (inferred from 62% identity to pat:Patl_0914)

Predicted SEED Role

"conserved hypothetical protein-putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DZG1 at UniProt or InterPro

Protein Sequence (172 amino acids)

>PGA1_c11100 Predicted membrane protein (Phaeobacter inhibens DSM 17395)
MFVENILTDFLLRSAVLSSIAIIWVIVVVRLVGLRAFSKMTAFDFVVTVAIGSLLAGASQ
ATSWTSFGQSALSIAILLCVQYLVARLRQSSEKFKAAVQNTPVMLMRDGDILQSALAATR
VSEDDLLAKLREANVLSFSQVRAVVLETTGDISVLHGDSLETRLIVGVEVPS