Protein Info for PGA1_c11050 in Phaeobacter inhibens DSM 17395

Annotation: FAD dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF01494: FAD_binding_3" amino acids 7 to 341 (335 residues), 115.8 bits, see alignment E=9.1e-37 PF13450: NAD_binding_8" amino acids 10 to 38 (29 residues), 26.4 bits, see alignment (E = 2.4e-09) PF00890: FAD_binding_2" amino acids 10 to 39 (30 residues), 21.2 bits, see alignment (E = 5.2e-08)

Best Hits

KEGG orthology group: K00480, salicylate hydroxylase [EC: 1.14.13.1] (inferred from 70% identity to sit:TM1040_0896)

Predicted SEED Role

"Salicylate hydroxylase (EC 1.14.13.1)" in subsystem Salicylate and gentisate catabolism or Salicylate ester degradation (EC 1.14.13.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EY61 at UniProt or InterPro

Protein Sequence (408 amino acids)

>PGA1_c11050 FAD dependent oxidoreductase (Phaeobacter inhibens DSM 17395)
MRLTDRKITIIGAGIGGLAAALAFSRQGAKVTVLEQAEAITEVGAGLQISPNGVAVLRAL
GLADDLAWSAPRARAVVLRSHRRGREVLRLDLDQYAPGQNFYFAHRADLINLLADAARQA
GVKVRLLQKVDRITSGARPVVHLANGAQCSGDLVIGADGLHSKARAALNGVATPRFTGQV
AWRATVANLHNHPAEAQVFMGPGRHLVTYPLRDSSLMNIVAVQERKTWAEEGWHHRDDPE
ALRSAFTGFGGAAADLLAQVDQVALWGLFRHPVAEVWHQGSLAIMGDAAHPTLPFMAQGA
NLALEDAWVLVDALRTASSDEEGLAAYQQRRRSRAAKVVDAATGNAWKYHLRQPLAWPAH
QILRLGGRLAPQRMVQQFDWIYGHDVTGGTPAPTGNDPGAGGPITTLA