Protein Info for HP15_1068 in Marinobacter adhaerens HP15

Annotation: transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 794 transmembrane" amino acids 30 to 49 (20 residues), see Phobius details amino acids 241 to 263 (23 residues), see Phobius details amino acids 269 to 290 (22 residues), see Phobius details amino acids 297 to 321 (25 residues), see Phobius details amino acids 340 to 362 (23 residues), see Phobius details amino acids 370 to 398 (29 residues), see Phobius details amino acids 422 to 446 (25 residues), see Phobius details amino acids 631 to 650 (20 residues), see Phobius details amino acids 652 to 676 (25 residues), see Phobius details amino acids 681 to 702 (22 residues), see Phobius details amino acids 728 to 748 (21 residues), see Phobius details amino acids 756 to 781 (26 residues), see Phobius details PF03176: MMPL" amino acids 211 to 420 (210 residues), 33.7 bits, see alignment E=1e-12 amino acids 481 to 780 (300 residues), 68.1 bits, see alignment E=3.5e-23

Best Hits

KEGG orthology group: K07003, (no description) (inferred from 92% identity to maq:Maqu_2064)

Predicted SEED Role

"FIG005548: transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PG90 at UniProt or InterPro

Protein Sequence (794 amino acids)

>HP15_1068 transporter (Marinobacter adhaerens HP15)
MSNPKHDKGEHYLTTPKAEPFLERLIFNNRAVILIAFAILTMFLGYNAVKIQPDASFERM
IPLEHPYIVNMLDHRDDLENLGNFVRIAVESKEGDIFTQEYMETLKQITDEVFYLNGVDR
SGLKSLWTSNVRWVEVTEQGFQGGTVIPDGYDGSRESLEQLRQNVLRSNEVGRLISDNFN
STIVYAPLYEKNPETGEALDYGDFSRQLEEKIREKYEEQNPNIKIHIVGFAKKVGDLIEG
IGSIAWFAGITILLTTLLLFWYSRSITGTLVPVFTSIIAVFLQLGTLRLLGYGLDPYSVL
VPFLVFAIGISHGVQIVNAMAVEAAKGFDAVTAARLAFRALYIPGMLALISDAFGFLTLF
FIEIDVIRDLAVAAGIGVAFVILTNLVLHVLIMSYIGISKGGIRHVQNHGEKQDRKWRVL
SYFSHPGVAPISLLIAVIGLGLGLYYKQNLKIGDLDQGAPELRADSRYNKDNAYIINNYS
TSADVLVVMVKTPEEQCTQYNVLRAMDSLQWELQNTPGVQSSVSLADVSKMVTKALNEGN
WKWFEISRNQTIINASIREAPAGLINTDCSLTPVLVFLEDHKAETLETVVDRVEEFAQNN
STEEHRFLLAAGNAGVESATNEVISAAKDKMLILVYGVVSLLCFVTFRSIRAVLCIVIPL
GLTSVLCEAIMAVSGIGIKVATLPVIALGVGIGVDYGIYIYSKLEKYLLEGKTLQDAYYE
TLRSTGKAVMFTGVTLGLGVVTWIFSPIKFQADMGFLLFFMFLWNMVGAIWLLPALARFL
LRPDQMLAKARAAK