Protein Info for PGA1_c11040 in Phaeobacter inhibens DSM 17395

Annotation: dnaK suppressor protein DksA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 148 TIGR02420: RNA polymerase-binding protein DksA" amino acids 28 to 137 (110 residues), 149.7 bits, see alignment E=1.8e-48 PF21157: DksA_N" amino acids 32 to 102 (71 residues), 105.1 bits, see alignment E=1.8e-34 PF01258: zf-dskA_traR" amino acids 105 to 140 (36 residues), 41.1 bits, see alignment E=1.4e-14

Best Hits

Swiss-Prot: 73% identical to DKSA_CAUVC: RNA polymerase-binding transcription factor DksA (dksA) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K06204, DnaK suppressor protein (inferred from 91% identity to sit:TM1040_0895)

Predicted SEED Role

"C4-type zinc finger protein, DksA/TraR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DZF7 at UniProt or InterPro

Protein Sequence (148 amino acids)

>PGA1_c11040 dnaK suppressor protein DksA (Phaeobacter inhibens DSM 17395)
MGQTKGTEMKQEVFLPDDYRPAEDEPFMNDRQQEYFRRKLHEWKQELLAESRDTIEGLQD
NTRNIPDVADRASEETDRALELRTRDRQRKLVAKIDSAIRRIDEGEYGYCEVTGEPISLK
RLDARPIATMSLEAQERHERREKVHRDD