Protein Info for HP15_108 in Marinobacter adhaerens HP15

Annotation: outer membrane efflux protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 PF02321: OEP" amino acids 22 to 157 (136 residues), 59.7 bits, see alignment E=1.7e-20 amino acids 182 to 356 (175 residues), 99.3 bits, see alignment E=1.2e-32

Best Hits

Predicted SEED Role

"Heavy metal RND efflux outer membrane protein, CzcC family" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PJ53 at UniProt or InterPro

Protein Sequence (365 amino acids)

>HP15_108 outer membrane efflux protein (Marinobacter adhaerens HP15)
MQEADLDHASRWAPSNPELELSGRDNPDQADQALNYEVRVTQEVWMGNRGDLGQSRAQST
LTSQQQELEYLKVATKARVRSAYFKILLAQKELETASRTVELMRRTKELVEVSVERGKQT
RIDLNTAVIGLARAKNQKAEAEQKLRQSKIDLTEVLGVSPSDAVEVLGELNVARANLPPT
NRLVAMAQRQRGDLKAAAARIAANESGLKLAKSLTIPNLKVFGFYEREERSNLFGAGVSM
PLTVFHDYSGEKRKASAQLKISELEAEALRLATERQVVSAVAQYESAVRRLRQMNESILE
RSEETLQLMQKALQAGKVDASDVLAAQDNLLSVRKEYVQVQHDYIDAVRALEVSTGGALS
MSSGS