Protein Info for Psest_1111 in Pseudomonas stutzeri RCH2

Annotation: Flp pilus assembly protein TadD, contains TPR repeats

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 575 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF04733: Coatomer_E" amino acids 158 to 341 (184 residues), 29.5 bits, see alignment E=4.3e-10 PF13432: TPR_16" amino acids 225 to 287 (63 residues), 27 bits, see alignment E=4.6e-09 amino acids 301 to 346 (46 residues), 16.3 bits, see alignment 1e-05 amino acids 428 to 493 (66 residues), 27.3 bits, see alignment E=3.7e-09 amino acids 473 to 525 (53 residues), 30 bits, see alignment 5.1e-10 PF14559: TPR_19" amino acids 235 to 289 (55 residues), 39.1 bits, see alignment 6.4e-13 amino acids 473 to 525 (53 residues), 31.1 bits, see alignment 2e-10 amino acids 506 to 560 (55 residues), 30.2 bits, see alignment 3.8e-10 PF13181: TPR_8" amino acids 324 to 347 (24 residues), 14 bits, see alignment (E = 4e-05) amino acids 460 to 492 (33 residues), 13.1 bits, see alignment (E = 7.9e-05) amino acids 498 to 526 (29 residues), 14 bits, see alignment (E = 4e-05) PF07721: TPR_4" amino acids 324 to 347 (24 residues), 10.8 bits, see alignment (E = 0.00061) PF13174: TPR_6" amino acids 324 to 348 (25 residues), 16 bits, see alignment (E = 1.3e-05) amino acids 499 to 526 (28 residues), 14.8 bits, see alignment (E = 3.1e-05) PF13374: TPR_10" amino acids 495 to 522 (28 residues), 19.2 bits, see alignment (E = 8.1e-07)

Best Hits

Swiss-Prot: 67% identical to Y4667_PSEAE: TPR repeat-containing protein PA4667 (PA4667) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 92% identity to psa:PST_3184)

Predicted SEED Role

"FIG140336: TPR domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJT8 at UniProt or InterPro

Protein Sequence (575 amino acids)

>Psest_1111 Flp pilus assembly protein TadD, contains TPR repeats (Pseudomonas stutzeri RCH2)
MKRLAALAALLFIGGCQTFTQQAPESSPPVEDAAPESSASDAAEYGSFSRQSLYALLVAE
LAGQRNRFDIALGNYVQQAHATQDAGVAERGFRIAEYLGAEQAALDTAMIWARNAPQSLD
AQRAAAVQLARAGRYEESMEFMEKVLQGQGDTHFDFLALSASETDPDTRAGLLQSFDKLL
LKHPDNPQLTFGKAVLLQQDDRSDEALSLLQKQPAKQRQIPSILLEARLLHSLQRSDEAL
PLLEKSLRQHPEDKRLRLTYARLLVEQERLEDAMGEFATLVQQYPADDDLRFSMALVCME
AEAWREATAYLEELIERGSHVDAAYFNLGRAYQAMGRNAKALDALAQVGPGNEYLPAKLL
QSQLLYSAKRDQEASAVLADARQRQPDYAIQLYLIEIEALSEHNRLEQAWKLAEQALEDF
PDDLNLLYTRAMLAEKRGDLAQLERDLRFIIEREPDNAMALNALGYTLADRTNRHDEALQ
LIEQAYQLNPDDPAILDSLGWVNFRLGNLTEAEALLRKALQRFPDHEVAAHLGEVLWTMG
ERSEARAVWAKALKLQPDSEILRETLKRLTGSEKP