Protein Info for PGA1_c10880 in Phaeobacter inhibens DSM 17395

Annotation: alanine racemase, biosynthetic

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00492: alanine racemase
  • amino acids 6 to 343 (338 residues), 214.1 bits, E=1.4e-67
• PF01168: Ala_racemase_N
  • amino acids 9 to 214 (206 residues), 164.8 bits, E=2.6e-52
• PF00842: Ala_racemase_C
  • amino acids 221 to 343 (123 residues), 126.8 bits, E=4.2e-41

Best Hits

Swiss-Prot: 79% identical to ALR_RUEST: Alanine racemase (alr) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K01775, alanine racemase [EC: 5.1.1.1] (inferred from 79% identity to sit:TM1040_1779)

Predicted SEED Role

"Alanine racemase (EC 5.1.1.1)" in subsystem Alanine biosynthesis or Pyruvate Alanine Serine Interconversions (EC 5.1.1.1)

MetaCyc Pathways

• alanine racemization (1/1 steps found)
• L-alanine degradation I (1/2 steps found)
• anaerobic energy metabolism (invertebrates, cytosol) (4/7 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (11/17 steps found)
• ansatrienin biosynthesis (1/9 steps found)
• cyclosporin A biosynthesis (2/15 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• D-Alanine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.1.1

Sequence Analysis Tools

See I7EKS7 at UniProt or InterPro

Protein Sequence (345 amino acids)

>PGA1_c10880 alanine racemase, biosynthetic (Phaeobacter inhibens DSM 17395)
MTTARLTLNLDALVTNWRNLDALTNCETAAVVKANGYGLDAGRVGRALANAGARNFFVAM
AEEGVALRRAIGPGPGISVFAGHMEGDAKLLRDFQLTPMLNSLDQMLRHFESLPGHPFGV
QLDTGMNRLGMEAAEWAAVRDIALSQGPVLLMSHLACADETTHPMNSHQLQNFLDLTEGL
DLPRSLAATGGLLLGRNYHFDLCRPGIGLYGGQPYGDALPVAQLDLPVIQIRSLDPGETV
GYGNSWAAQRPSRIATVAAGYADGLHRALGSGQIQVYAGDTPCPVVGRVSMDLITVDVTD
LGDDPSHLAILNERQTVDTLADAAGTIGYEILTSLGSRYARSYTG