Protein Info for PGA1_c10880 in Phaeobacter inhibens DSM 17395

Annotation: alanine racemase, biosynthetic

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 TIGR00492: alanine racemase" amino acids 6 to 343 (338 residues), 214.1 bits, see alignment E=1.4e-67 PF01168: Ala_racemase_N" amino acids 9 to 214 (206 residues), 164.8 bits, see alignment E=2.6e-52 PF00842: Ala_racemase_C" amino acids 221 to 343 (123 residues), 126.8 bits, see alignment E=4.2e-41

Best Hits

Swiss-Prot: 79% identical to ALR_RUEST: Alanine racemase (alr) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K01775, alanine racemase [EC: 5.1.1.1] (inferred from 79% identity to sit:TM1040_1779)

Predicted SEED Role

"Alanine racemase (EC 5.1.1.1)" in subsystem Alanine biosynthesis or Pyruvate Alanine Serine Interconversions (EC 5.1.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EKS7 at UniProt or InterPro

Protein Sequence (345 amino acids)

>PGA1_c10880 alanine racemase, biosynthetic (Phaeobacter inhibens DSM 17395)
MTTARLTLNLDALVTNWRNLDALTNCETAAVVKANGYGLDAGRVGRALANAGARNFFVAM
AEEGVALRRAIGPGPGISVFAGHMEGDAKLLRDFQLTPMLNSLDQMLRHFESLPGHPFGV
QLDTGMNRLGMEAAEWAAVRDIALSQGPVLLMSHLACADETTHPMNSHQLQNFLDLTEGL
DLPRSLAATGGLLLGRNYHFDLCRPGIGLYGGQPYGDALPVAQLDLPVIQIRSLDPGETV
GYGNSWAAQRPSRIATVAAGYADGLHRALGSGQIQVYAGDTPCPVVGRVSMDLITVDVTD
LGDDPSHLAILNERQTVDTLADAAGTIGYEILTSLGSRYARSYTG