Protein Info for HP15_1046 in Marinobacter adhaerens HP15

Annotation: competence damage-inducible protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 166 PF02464: CinA" amino acids 13 to 161 (149 residues), 181.7 bits, see alignment E=3.8e-58 TIGR00199: amidohydrolase, PncC family" amino acids 15 to 159 (145 residues), 177.1 bits, see alignment E=1.2e-56

Best Hits

Swiss-Prot: 60% identical to PNCC_SHIFL: Nicotinamide-nucleotide amidohydrolase PncC (pncC) from Shigella flexneri

KEGG orthology group: K03743, (no description) (inferred from 66% identity to maq:Maqu_2083)

Predicted SEED Role

"C-terminal domain of CinA paralog, YdeJ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PG69 at UniProt or InterPro

Protein Sequence (166 amino acids)

>HP15_1046 competence damage-inducible protein A (Marinobacter adhaerens HP15)
MLASDQELEEAGNRLGERLLTTGRTVATAESCTGGWVAKVLTDRAGSSAYVLGGLVTYSN
EAKQGLLGVTRKSLDEHGAVSEPVVREMVAGALVATDADVAVAISGVAGPGGGSEEKPVG
TVWFAWGSSPAFTVAVVKHFEGDRDQVRRQAVLFALQGVNNFVDEV