Protein Info for PGA1_c10770 in Phaeobacter inhibens DSM 17395
Annotation: 5'-nucleotidase SurE
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 74% identical to SURE_RUEST: 5'-nucleotidase SurE (surE) from Ruegeria sp. (strain TM1040)
KEGG orthology group: K03787, 5'-nucleotidase [EC: 3.1.3.5] (inferred from 74% identity to sit:TM1040_1791)Predicted SEED Role
"5-nucleotidase SurE (EC 3.1.3.5)" in subsystem Folate Biosynthesis (EC 3.1.3.5)
MetaCyc Pathways
- purine nucleotides degradation II (aerobic) (10/11 steps found)
- purine nucleotides degradation I (plants) (10/12 steps found)
- adenosine nucleotides degradation I (7/8 steps found)
- guanosine nucleotides degradation II (4/4 steps found)
- guanosine nucleotides degradation III (4/4 steps found)
- inosine 5'-phosphate degradation (4/4 steps found)
- ureide biosynthesis (6/7 steps found)
- superpathway of guanosine nucleotides degradation (plants) (5/6 steps found)
- adenosine nucleotides degradation II (4/5 steps found)
- guanosine nucleotides degradation I (3/4 steps found)
- UTP and CTP dephosphorylation I (5/7 steps found)
- NAD salvage pathway III (to nicotinamide riboside) (2/3 steps found)
- superpathway of purines degradation in plants (12/18 steps found)
- NAD salvage (plants) (6/11 steps found)
- tunicamycin biosynthesis (1/9 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from histidine and purine
- Nicotinate and nicotinamide metabolism
- Purine metabolism
- Pyrimidine metabolism
Isozymes
Compare fitness of predicted isozymes for: 3.1.3.5
Use Curated BLAST to search for 3.1.3.5
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See I7DP36 at UniProt or InterPro
Protein Sequence (260 amino acids)
>PGA1_c10770 5'-nucleotidase SurE (Phaeobacter inhibens DSM 17395) MRILITNDDGISAPGLAVLEQIARDVAGPDGEVWTVAPAFEQSGVGHCISYTRPFMLSQL GERRFAAEGSPADCVLAGLHVVMKDHLPDLVLSGVNRGNNSAENALYSGTLGGAMEAALQ GIPAMGLSQYFGPENNQLDNPFEAAADHGADLIRSILDTQSNEDTDYRLFYNINFPPVPA ADVKGRRIAPQGFRRGSHFSAEEQTSPNGRRYLWIRGGNQHIATAEGTDAAQNLAGYISV TPMRADLTATDALERLKGIE