Protein Info for PGA1_c10770 in Phaeobacter inhibens DSM 17395

Annotation: 5'-nucleotidase SurE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 TIGR00087: 5'/3'-nucleotidase SurE" amino acids 1 to 248 (248 residues), 187.2 bits, see alignment E=1.7e-59 PF01975: SurE" amino acids 3 to 195 (193 residues), 175.6 bits, see alignment E=4.8e-56

Best Hits

Swiss-Prot: 74% identical to SURE_RUEST: 5'-nucleotidase SurE (surE) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K03787, 5'-nucleotidase [EC: 3.1.3.5] (inferred from 74% identity to sit:TM1040_1791)

Predicted SEED Role

"5-nucleotidase SurE (EC 3.1.3.5)" in subsystem Folate Biosynthesis (EC 3.1.3.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.5

Use Curated BLAST to search for 3.1.3.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DP36 at UniProt or InterPro

Protein Sequence (260 amino acids)

>PGA1_c10770 5'-nucleotidase SurE (Phaeobacter inhibens DSM 17395)
MRILITNDDGISAPGLAVLEQIARDVAGPDGEVWTVAPAFEQSGVGHCISYTRPFMLSQL
GERRFAAEGSPADCVLAGLHVVMKDHLPDLVLSGVNRGNNSAENALYSGTLGGAMEAALQ
GIPAMGLSQYFGPENNQLDNPFEAAADHGADLIRSILDTQSNEDTDYRLFYNINFPPVPA
ADVKGRRIAPQGFRRGSHFSAEEQTSPNGRRYLWIRGGNQHIATAEGTDAAQNLAGYISV
TPMRADLTATDALERLKGIE