Protein Info for Psest_1093 in Pseudomonas stutzeri RCH2

Annotation: ABC-type branched-chain amino acid transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 transmembrane" amino acids 31 to 52 (22 residues), see Phobius details amino acids 56 to 98 (43 residues), see Phobius details amino acids 104 to 124 (21 residues), see Phobius details amino acids 130 to 151 (22 residues), see Phobius details amino acids 178 to 197 (20 residues), see Phobius details amino acids 228 to 253 (26 residues), see Phobius details amino acids 265 to 290 (26 residues), see Phobius details amino acids 302 to 326 (25 residues), see Phobius details PF02653: BPD_transp_2" amino acids 52 to 314 (263 residues), 123.8 bits, see alignment E=3.6e-40

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 98% identity to psa:PST_3204)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GK16 at UniProt or InterPro

Protein Sequence (335 amino acids)

>Psest_1093 ABC-type branched-chain amino acid transport system, permease component (Pseudomonas stutzeri RCH2)
MTNPANVQAAALRHASVVRERRHAAARRQKVFYAVLLVIALLAPLAVYPVFLMKLLCFAL
FACAFNLLLGYAGLLSFGHAAFFATGGYITGYMLSSYSGLSTELGILAGTLASTVLGGLF
GMLAIRRQGIYFAMITLALAQLVFFVFVQAPFTGGENGLQGVPRGHLFGLVDMKNNMAMY
YFVLAVFVLGFAIIQRTIHSPYGQVLKAIRENEPRAVSLGYNVDRHKLLAFVISAALAGL
AGATKTVVFQLASLTDAHWHMSGEVILMTLLGGVGTILGPLVGATVVVTLQSSLSNGPLG
EWVHVILGVIFVLCVLLFRSGIVGWLERLVKRNFK