Protein Info for PGA1_c10760 in Phaeobacter inhibens DSM 17395

Annotation: protein-L-isoaspartate O-methyltransferase Pcm

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 TIGR00080: protein-L-isoaspartate O-methyltransferase" amino acids 7 to 211 (205 residues), 197.3 bits, see alignment E=1.4e-62 PF01135: PCMT" amino acids 11 to 209 (199 residues), 195.3 bits, see alignment E=2.2e-61 PF13847: Methyltransf_31" amino acids 78 to 173 (96 residues), 32 bits, see alignment E=2e-11 PF13649: Methyltransf_25" amino acids 82 to 152 (71 residues), 32.5 bits, see alignment E=2.4e-11 PF08241: Methyltransf_11" amino acids 83 to 155 (73 residues), 24.8 bits, see alignment E=5.4e-09

Best Hits

Swiss-Prot: 86% identical to PIMT_RUEST: Protein-L-isoaspartate O-methyltransferase (pcm) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K00573, protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC: 2.1.1.77] (inferred from 86% identity to sit:TM1040_1792)

MetaCyc: 45% identical to protein-L-isoaspartate O-methyltransferase (Escherichia coli K-12 substr. MG1655)
Protein-L-isoaspartate(D-aspartate) O-methyltransferase. [EC: 2.1.1.77]

Predicted SEED Role

"Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77)" in subsystem Ton and Tol transport systems (EC 2.1.1.77)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.77

Use Curated BLAST to search for 2.1.1.77

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EY39 at UniProt or InterPro

Protein Sequence (215 amino acids)

>PGA1_c10760 protein-L-isoaspartate O-methyltransferase Pcm (Phaeobacter inhibens DSM 17395)
MSEPTAETKMQFLFALRSRGVTDAQVLDAMEQIDRGPFVRGLFSARAYEDMPLPIACGQT
ISQPSVVGLMTQALQISPRDTVLEVGTGSGYQAAILSKLARRVYTVDRHARLVREARQIF
DQLHLSNITSLVGDGSHGLPEQAPFDRIIVTAAAEDPPGPLLAQLKTGGIMVVPVGQSDT
VQTLIRVQKTASGLEYDELRPVRFVPLLEGIGKDT