Protein Info for HP15_1038 in Marinobacter adhaerens HP15

Annotation: sensory box histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 504 TIGR00229: PAS domain S-box protein" amino acids 119 to 242 (124 residues), 65 bits, see alignment E=3.6e-22 PF00989: PAS" amino acids 122 to 218 (97 residues), 29.2 bits, see alignment E=2e-10 PF08448: PAS_4" amino acids 135 to 237 (103 residues), 38.9 bits, see alignment E=2.2e-13 PF13426: PAS_9" amino acids 139 to 235 (97 residues), 43.9 bits, see alignment E=6.3e-15 PF00512: HisKA" amino acids 259 to 328 (70 residues), 30.6 bits, see alignment E=7e-11 PF02518: HATPase_c" amino acids 374 to 487 (114 residues), 61.4 bits, see alignment E=2.7e-20

Best Hits

KEGG orthology group: None (inferred from 75% identity to maq:Maqu_2094)

Predicted SEED Role

"Signal transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PG60 at UniProt or InterPro

Protein Sequence (504 amino acids)

>HP15_1038 sensory box histidine kinase (Marinobacter adhaerens HP15)
MNDFSTPSVFSLHDADPQPGLILDATGSVLEGNLASHHLCQNANLTSLFHLLPVNVQALV
KSSLEQERSIENVEARIPADTTERFLVWTFVPDIGSSTVLARAKDATDEIINREEATRSN
RLYRLITENTTDLISRHAPDGRFIDATPASWRLLGYWPEELRGKPLEEIFRGDQVVQKLA
ETRNQLRDDGYATMTLEIIHRDGSRRWFEIASRAIRETYTGAVIEVISVSRDITARVESE
ENNRRLADELAHTARLATLGELASSIAHEMNQPLATIVNFASASQRYLKSARTNPECLDR
VDDGLQKIVHHANRASEVIKRLRAFLRKGQKRTAPIALNEVVSNVARLCQWEAEKNKVQI
RENLACCAPVITADPVLLEQVLINLIRNGIEATVEARGEDNPGPHSQIAITTCINDQNET
LIEVIDEGPGLDAQGIRQMFQPFYTSKPQGLGLGLSMSRSIIEGFGGFLDARPAATGGLS
LICRFPASPGHKNRTPNTEMQPDE