Protein Info for Psest_1090 in Pseudomonas stutzeri RCH2

Annotation: ABC-type branched-chain amino acid transport systems, ATPase component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 PF00005: ABC_tran" amino acids 25 to 166 (142 residues), 86 bits, see alignment E=1.9e-28

Best Hits

KEGG orthology group: K01996, branched-chain amino acid transport system ATP-binding protein (inferred from 98% identity to psa:PST_3207)

Predicted SEED Role

"Branched-chain amino acid transport ATP-binding protein LivF (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GI22 at UniProt or InterPro

Protein Sequence (238 amino acids)

>Psest_1090 ABC-type branched-chain amino acid transport systems, ATPase component (Pseudomonas stutzeri RCH2)
MNPPMDRDQLRVSDLHAFYGESHILHGVDLVVGRGELVTLLGRNGAGRSTTLRAIMNMVG
RRTGSIVVNGNETIGMPAHQIPRLGVGYCPEERGIFASLSVEENLLLPPTVRSGGMSLDE
LYEMFPNLYERRFSQGTRLSGGEQQMLAMARILRTGANLLLLDEITEGLAPVIVQKLGEV
LIKLKQRGLTIVLVEQNFRFAAPLADRHYVMEHGRIIEEIEAADLDSKKDFLNSCLGV