Protein Info for Psest_1080 in Pseudomonas stutzeri RCH2

Annotation: Acetyl/propionyl-CoA carboxylase, alpha subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 633 PF00289: Biotin_carb_N" amino acids 1 to 110 (110 residues), 145.1 bits, see alignment E=5.1e-46 PF02786: CPSase_L_D2" amino acids 116 to 322 (207 residues), 270 bits, see alignment E=5.9e-84 PF02222: ATP-grasp" amino acids 137 to 292 (156 residues), 42.2 bits, see alignment E=3.2e-14 PF07478: Dala_Dala_lig_C" amino acids 139 to 291 (153 residues), 47.6 bits, see alignment E=7e-16 PF02785: Biotin_carb_C" amino acids 336 to 443 (108 residues), 123.8 bits, see alignment E=1.5e-39 PF21139: MCC_alpha_BT" amino acids 458 to 546 (89 residues), 105.6 bits, see alignment E=6.3e-34 PF00364: Biotin_lipoyl" amino acids 565 to 630 (66 residues), 64.8 bits, see alignment E=2.3e-21 PF13533: Biotin_lipoyl_2" amino acids 566 to 607 (42 residues), 23.7 bits, see alignment 1.5e-08

Best Hits

KEGG orthology group: K01968, 3-methylcrotonyl-CoA carboxylase alpha subunit [EC: 6.4.1.4] (inferred from 97% identity to psa:PST_3216)

Predicted SEED Role

"Methylcrotonyl-CoA carboxylase biotin-containing subunit (EC 6.4.1.4)" in subsystem HMG CoA Synthesis or Leucine Degradation and HMG-CoA Metabolism or Serine-glyoxylate cycle (EC 6.4.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.4.1.4

Use Curated BLAST to search for 6.4.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GI14 at UniProt or InterPro

Protein Sequence (633 amino acids)

>Psest_1080 Acetyl/propionyl-CoA carboxylase, alpha subunit (Pseudomonas stutzeri RCH2)
MITTLLVANRGEIACRVMRTAKAMGLTTVAVHSAIDATARHAREADIRIDLGGAKPADSY
LRIDKLIDAAKASGAQAIHPGYGFLSENAEFARAIEQAGLIFLGPPASAIDAMGSKSAAK
ALMEEAGVPLVPGYHGEAQDVETFRAAAEKIGYPVLLKATAGGGGKGMKVVEREADLAEA
LASAQREAQSSFGDWRMLVEKYVLKPRHVEIQVFADQHGNCLYLNERDCSIQRRHQKVVE
EAPAPGLTPELRRAMGEAAVKAAQAIGYVGAGTVEFLLDARGEFFFMEMNTRLQVEHPVT
EAITGLDLVAWQIRVARGEPLPISQEQVPLIGHAIEVRLYAEDPDNDFLPATGTLDLYRE
AAEGPGRRVDSGVAEGDTVSPFYDPMLGKLIAWGENREEARLRLLAMLDETAVGGVRTNL
AFLRRVVGHRAFAEAELDTAFIPRHESELLRPAGELSDAFWQQAAECFVQTEPTKVRGDD
AHSPWSKRSGLRFGMPAQISLHLQCNGESRRLKVDPAAPQPNVRTPKAIRQGDALYLQWN
GEWLAVRAFDPIAEAEASHQHHGGLTAPMNGSIVRVLVEAGQHVEAGTALIVLEAMKMEH
SIRSAQAGVVKSLFCSEGEMVSEGAVLLEMEEA