Protein Info for PGA1_c10580 in Phaeobacter inhibens DSM 17395

Annotation: ribonuclease J 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 555 PF00753: Lactamase_B" amino acids 20 to 168 (149 residues), 47.1 bits, see alignment E=7.4e-16 PF12706: Lactamase_B_2" amino acids 60 to 171 (112 residues), 48.9 bits, see alignment E=1.6e-16 PF22505: RNase_J_b_CASP" amino acids 227 to 349 (123 residues), 119.3 bits, see alignment E=2.3e-38 PF07521: RMMBL" amino acids 366 to 410 (45 residues), 37.3 bits, see alignment 5.5e-13 PF17770: RNase_J_C" amino acids 453 to 553 (101 residues), 81.4 bits, see alignment E=2.1e-26

Best Hits

KEGG orthology group: K07021, (no description) (inferred from 82% identity to sit:TM1040_0763)

Predicted SEED Role

"Metallo-beta-lactamase family protein, RNA-specific" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DP16 at UniProt or InterPro

Protein Sequence (555 amino acids)

>PGA1_c10580 ribonuclease J 1 (Phaeobacter inhibens DSM 17395)
MSTERLIYLPLGGAGEIGMNAYVYGYGKPGKERLILVDLGVTFPDMDSSPGVDLIMPDIR
WLKERADQLEGVFITHAHEDHIGAVAHLYRDLNVPIYARAFTANLARRKMDEAGLDSEEV
KTVSAWPEVTKLGPFTVGVAPISHSIPESGGLVIDTPAGRIVHTGDFKTDPTPIVGEAFD
PEMWAEIAKDGVKALVCDSTNVFSLHPGRSEVEVGPEITRLVGEAEGMVVATTFASNVAR
VKTLAEAGHAAGRSVVLLGRAMQRMVEAATETGVLKNFPKVVSVEAAQELPRENLMLVVT
GSQGERRAASAQLARGKYRGVEVKEGDLFLFSSKTIPGNERGVIRIINQFSEKGVDVVDD
SSGLYHVSGHANRPDLERMHDIIKPQMLIPMHGEHRHLRQHARLGEAKGIASAVAVNGMM
MDLTGDSPKVVDYVDTGRTYLDGSVKYGALDGVVRDRIRMALNGHVVVTVILDEEDEPLG
EPWCDIKGLAETGRSNAALVEVMEEDLNQFIMRAGAKTLRDDDKLEENLRRVARQSAQNE
IGKKPEVTVVVSRMR