Protein Info for Psest_1073 in Pseudomonas stutzeri RCH2

Annotation: TRAP-type mannitol/chloroaromatic compound transport system, small permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 transmembrane" amino acids 28 to 52 (25 residues), see Phobius details amino acids 67 to 85 (19 residues), see Phobius details amino acids 106 to 131 (26 residues), see Phobius details amino acids 151 to 170 (20 residues), see Phobius details PF04290: DctQ" amino acids 44 to 175 (132 residues), 86.9 bits, see alignment E=5.5e-29

Best Hits

KEGG orthology group: None (inferred from 98% identity to psa:PST_3223)

Predicted SEED Role

"TRAP dicarboxylate transporter, DctQ subunit, unknown substrate 6"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJZ6 at UniProt or InterPro

Protein Sequence (200 amino acids)

>Psest_1073 TRAP-type mannitol/chloroaromatic compound transport system, small permease component (Pseudomonas stutzeri RCH2)
MSFKPVSPDTPAPDALPYNRISRPLDRLLVAIGEASAWLWLAVLLVVLANVFSRFALSRG
SIALEELSWHLFGAALMLALAYAVVRDDHVRVDVLRERFSLRSQAWIELIAILLLALPVI
VLMIDALIPYAYKAYLYNERSQAPSGLPYRFIFKSVLPIGLVLVALALLSRALRCSTLLF
NFPRALTAPSDERDRTRSQP