Protein Info for PGA1_c10560 in Phaeobacter inhibens DSM 17395

Annotation: biotin-[acetyl-CoA-carboxylase] synthetase BirA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 TIGR00121: biotin--[acetyl-CoA-carboxylase] ligase" amino acids 13 to 247 (235 residues), 117.6 bits, see alignment E=3.2e-38 PF03099: BPL_LplA_LipB" amino acids 18 to 138 (121 residues), 72.7 bits, see alignment E=4.4e-24 PF16917: BPL_LplA_LipB_2" amino acids 51 to 199 (149 residues), 30.2 bits, see alignment E=5e-11 PF02237: BPL_C" amino acids 205 to 249 (45 residues), 33.4 bits, see alignment 5e-12

Best Hits

Swiss-Prot: 57% identical to BIRA_PARDE: Biotin--[acetyl-CoA-carboxylase] ligase (birA) from Paracoccus denitrificans

KEGG orthology group: K03524, BirA family transcriptional regulator, biotin operon repressor / biotin-[acetyl-CoA-carboxylase] ligase [EC: 6.3.4.15] (inferred from 76% identity to sit:TM1040_0761)

Predicted SEED Role

"Biotin--protein ligase (EC 6.3.4.9, EC 6.3.4.10, EC 6.3.4.11, EC 6.3.4.15)"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DZB6 at UniProt or InterPro

Protein Sequence (249 amino acids)

>PGA1_c10560 biotin-[acetyl-CoA-carboxylase] synthetase BirA (Phaeobacter inhibens DSM 17395)
MSDWPEGYGRSLLEEVDSTLDEAARRAPTLTGPEWIMAKRQTKGRGRRGRAWKEPKGNFA
ATLVMRPEGPPDQVALRSFVAALALYDACVALCGETAGLALKWPNDVLLNGGKLAGILLE
SAGAAGGVTHLSIGLGVNLIETPMQEWLEPGAVWPVSLLSETGIHVTPEDFLTELAAAYD
RYEIQFVTYGFEPIRTAWLARAARLGEVIIARTSNSETEGTFETVDANGNLVLKTAKGRV
NIPAADIFF