Protein Info for Psest_1071 in Pseudomonas stutzeri RCH2

Annotation: Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 499 PF08448: PAS_4" amino acids 39 to 126 (88 residues), 29.6 bits, see alignment E=2.7e-10 PF00989: PAS" amino acids 39 to 126 (88 residues), 26.7 bits, see alignment E=1.9e-09 PF14532: Sigma54_activ_2" amino acids 169 to 340 (172 residues), 69 bits, see alignment E=2.2e-22 PF00158: Sigma54_activat" amino acids 169 to 335 (167 residues), 229.5 bits, see alignment E=7.9e-72 PF07728: AAA_5" amino acids 192 to 310 (119 residues), 23.9 bits, see alignment E=1.5e-08 PF25601: AAA_lid_14" amino acids 341 to 422 (82 residues), 71.8 bits, see alignment E=1.3e-23 PF02954: HTH_8" amino acids 454 to 493 (40 residues), 40.4 bits, see alignment 8e-14

Best Hits

KEGG orthology group: None (inferred from 98% identity to psa:PST_3225)

Predicted SEED Role

"sigma54 specific transcriptional regulator, Fis family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GIM9 at UniProt or InterPro

Protein Sequence (499 amino acids)

>Psest_1071 Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains (Pseudomonas stutzeri RCH2)
MSIARDALDNHGLIVGVSPERFRAVAMPLLFDHLNAQCEGTIAVNRQARIVWINDKYAEK
VGIRDPSSVLGKEIEEVLPASRLREVVESGQPSMIDLMAFGDEHFVVTRIPLRDEDGTLV
GALGFVLFDRARHLKPLMAKFTSLQTQLVATQNELAKARRARYTIAGFIGNSPAASEIKR
QARRAAQLDATVLLRGETGTGKELLAQGIHNLSPRARGPFVAVNVAAIPESLVEAELFGT
APGAFTGADRKARIGKFEVANGGTLFLDEIGDLPLPLQAKLLRVLQEQEVEPLGSNQVKA
LNVRVIAATHIDLEAKVAAGQFRDDLYYRLNVLALRVPPLRERSSDIPAVVEHLLDDIAN
RSGQPPMELSPEALALLCAQPWRGNVRELGNLLERAQLSADGPQLQAAHLLPLLGEQARS
ADAPAYATSAPSAALPTEATPSEELPLQPLAQTIAQAERRALQSALAACKGNRRRAAMEL
GISRASLYSKLQQHGLSQR