Protein Info for Psest_1070 in Pseudomonas stutzeri RCH2

Annotation: Predicted membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 132 transmembrane" amino acids 8 to 27 (20 residues), see Phobius details amino acids 33 to 53 (21 residues), see Phobius details amino acids 59 to 86 (28 residues), see Phobius details amino acids 100 to 124 (25 residues), see Phobius details PF07681: DoxX" amino acids 7 to 87 (81 residues), 77.4 bits, see alignment E=5.6e-26

Best Hits

KEGG orthology group: None (inferred from 93% identity to psa:PST_3226)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GI05 at UniProt or InterPro

Protein Sequence (132 amino acids)

>Psest_1070 Predicted membrane protein (Pseudomonas stutzeri RCH2)
MTDDAGKLVLRLSVGVLLLLHGIHKLLHGVDGIAGMLGGMGLPTFLAYGVYLGEVVGPLL
VILGLYTRLGALLMLGNMVVALALAHRAELFDIGPMGGWAIELQGLFLFGALAIMLLGAG
RYSVGGINGRYN