Protein Info for HP15_1014 in Marinobacter adhaerens HP15

Annotation: nitrate ABC transporter, ATPase subunits C and D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 TIGR01184: nitrate ABC transporter, ATP-binding proteins C and D" amino acids 27 to 255 (229 residues), 311.6 bits, see alignment E=1.6e-97 PF00005: ABC_tran" amino acids 27 to 167 (141 residues), 112 bits, see alignment E=1.9e-36

Best Hits

Swiss-Prot: 50% identical to CMPD_SYNP6: Bicarbonate transport ATP-binding protein CmpD (cmpD) from Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)

KEGG orthology group: K02049, sulfonate/nitrate/taurine transport system ATP-binding protein (inferred from 69% identity to tkm:TK90_0962)

Predicted SEED Role

"Cyanate ABC transporter, ATP-binding protein" in subsystem Cyanate hydrolysis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PFM9 at UniProt or InterPro

Protein Sequence (302 amino acids)

>HP15_1014 nitrate ABC transporter, ATPase subunits C and D (Marinobacter adhaerens HP15)
MSKSFLEVDGLSKVYPDGQGGELTVFEDIRFALEKGEFVCIIGHSGCGKSTILNVLAGLD
EASAGNVVMNGKEIKGPGLERGVVFQNYSLLPWKTTLNNIVFAVRARWPEWSKEKVKEHS
ERYLKMVGLDHALNRKPSQLSGGMRQRVSIARAFATQPELLLLDEPFGALDALTRGVIQD
ELVKIWEETRQTVFMITHDVDEAILLSDRIFLMSNGPNARIAESVKVDIPHPRARATIFQ
NPAYHKTRDYLVDFLVNRSGSALPEKDGTPKIVEPAQGVAQSGPASDESETESETAARAV
NA