Protein Info for PGA1_c10480 in Phaeobacter inhibens DSM 17395

Annotation: NADH-quinone oxidoreductase subunit H

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00146: NADHdh
  • amino acids 18 to 325 (308 residues), 403.5 bits, E=3.1e-125

Best Hits

Swiss-Prot: 94% identical to NUOH_RUEPO: NADH-quinone oxidoreductase subunit H (nuoH) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K00337, NADH dehydrogenase I subunit H [EC: 1.6.5.3] (inferred from 94% identity to sil:SPO2772)

MetaCyc: 58% identical to MbhM (Pyrococcus furiosus)
Ferredoxin hydrogenase. [EC: 1.12.7.2]

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain H (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• aerobic respiration III (alternative oxidase pathway) (3/3 steps found)
• hydrogen production III (1/1 steps found)
• hydrogen production VIII (1/1 steps found)
• aerobic respiration I (cytochrome c) (3/4 steps found)
• NADH to cytochrome bd oxidase electron transfer I (1/2 steps found)
• NADH to cytochrome bo oxidase electron transfer I (1/2 steps found)
• hydrogen production VI (1/2 steps found)
• superpathway of hydrogen production (1/2 steps found)
• NAD(P)/NADPH interconversion (3/6 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (5/9 steps found)
• Fe(II) oxidation (2/6 steps found)
• superpathway of photosynthetic hydrogen production (2/6 steps found)
• L-glutamate degradation VII (to butanoate) (4/12 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Methane metabolism
• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.12.7.2 or 1.6.5.3

Sequence Analysis Tools

See I7DP06 at UniProt or InterPro

Protein Sequence (345 amino acids)

>PGA1_c10480 NADH-quinone oxidoreductase subunit H (Phaeobacter inhibens DSM 17395)
MAEFFNTPGGIAVLILAQVLAVVAFVMISLLFLVYGDRKIWAAVQMRRGPNVVGVYGLLQ
SVADALKYVVKEVVIPAGADRTVFILAPLTSFVLAMIAWAVIPFNDGWVLSDINVAILYV
FAVSSLEVYGVIMGGWASNSKYPFLGSLRSAAQMISYEVSIGLIIVGVIISTGSMNFGDI
VRAQDGDLGLLNWYWIPHFPMVFLFFISALAETNRPPFDLPEAESELVAGYQVEYSATPF
LLFMAGEYIAIFLMCALTTLLFFGGWLSPIPGLPDGVLWMVAKMAFFFFLFAMVKAITPR
YRYDQLMRLGWKVFLPFSLAWVVFVSFAAKFDWFWGIFARWTVGG