Protein Info for Psest_1063 in Pseudomonas stutzeri RCH2

Annotation: Predicted permease, DMT superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 39 to 59 (21 residues), see Phobius details amino acids 70 to 90 (21 residues), see Phobius details amino acids 97 to 119 (23 residues), see Phobius details amino acids 126 to 144 (19 residues), see Phobius details amino acids 154 to 175 (22 residues), see Phobius details amino acids 187 to 207 (21 residues), see Phobius details amino acids 219 to 240 (22 residues), see Phobius details amino acids 252 to 271 (20 residues), see Phobius details amino acids 277 to 294 (18 residues), see Phobius details PF00892: EamA" amino acids 12 to 140 (129 residues), 62.8 bits, see alignment E=2.1e-21 amino acids 156 to 294 (139 residues), 88.3 bits, see alignment E=2.9e-29

Best Hits

KEGG orthology group: None (inferred from 99% identity to psa:PST_3233)

Predicted SEED Role

"protein of unknown function DUF6, transmembrane"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJP6 at UniProt or InterPro

Protein Sequence (299 amino acids)

>Psest_1063 Predicted permease, DMT superfamily (Pseudomonas stutzeri RCH2)
MNSRHAPAFAGLLIAVLCWSGNALVARAFYDQIPPLSLSFWRWVLATCLLLPFVAKGIWT
HRAALRAAGWRLPVIAALGIASYNSLLYTAAQSTEAINLTLVNTCLPLATFIGAGFLLGE
WPLRRAWFGMAVAAAGLLYLISRGSWQTFASLSFKAGDLIMLLAVLVWALYTLLLRRWSS
FLTVPPLVLLGVLMLLGVPLILPFYLYELSRVGGFAATPANLGAIGYTAVFASLIAYLAW
NHGVKVVGAAKAAMASYLMPVFTALLGWLLLGEALQPFHWIGGALIFAGLLLATRPSFR