Protein Info for PGA1_c01050 in Phaeobacter inhibens DSM 17395

Annotation: putative signal peptidase I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 transmembrane" amino acids 18 to 38 (21 residues), see Phobius details PF10502: Peptidase_S26" amino acids 12 to 254 (243 residues), 158.8 bits, see alignment E=6.1e-51 TIGR02227: signal peptidase I" amino acids 15 to 256 (242 residues), 144.5 bits, see alignment E=1.3e-46

Best Hits

KEGG orthology group: K03100, signal peptidase I [EC: 3.4.21.89] (inferred from 76% identity to sit:TM1040_2560)

Predicted SEED Role

"Signal peptidase I (EC 3.4.21.89)" in subsystem Signal peptidase (EC 3.4.21.89)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.21.89

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DL59 at UniProt or InterPro

Protein Sequence (278 amino acids)

>PGA1_c01050 putative signal peptidase I (Phaeobacter inhibens DSM 17395)
MTAKATVGSSILETVKTIVYALLIAGVFRTLFFQPFWIPSGSMKETLLIGDFLFVNKMAY
GYSSASCPSLKFPSVGIDIDSSDICGFLDGDNSRIWAGEPERGDVVVFRHPVNQNDFIKR
LIGLPGDKIQVKNGVLHINGAAVALQDAGDFEELMAPQGPAGSYPLCENAPVGEGAMCTK
SRQIETLPGGSQHVVLNIGNQGMDHTGIYQVPEGHYFFMGDNRDNSSDSRLPQSAGGVGY
VPYENLIGRADRIMFSSAGRSMLFFWTWRGNRFFKGIE