Protein Info for HP15_1007 in Marinobacter adhaerens HP15

Annotation: 3-hydroxyacyl-CoA dehydrogenase type II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF00106: adh_short" amino acids 7 to 202 (196 residues), 156.2 bits, see alignment E=1.2e-49 PF08659: KR" amino acids 9 to 163 (155 residues), 27.9 bits, see alignment E=3.1e-10 PF13561: adh_short_C2" amino acids 14 to 231 (218 residues), 151 bits, see alignment E=6.5e-48

Best Hits

Swiss-Prot: 52% identical to HCD2_DROME: 3-hydroxyacyl-CoA dehydrogenase type-2 (scu) from Drosophila melanogaster

KEGG orthology group: None (inferred from 91% identity to maq:Maqu_2119)

MetaCyc: 56% identical to 3-hydroxy-2-methylbutyryl-CoA dehydrogenase subunit (Pseudomonas putida)
3-hydroxy-2-methylbutyryl-CoA dehydrogenase. [EC: 1.1.1.178]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.178

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PFM2 at UniProt or InterPro

Protein Sequence (253 amino acids)

>HP15_1007 3-hydroxyacyl-CoA dehydrogenase type II (Marinobacter adhaerens HP15)
MEFKNVAAIVTGGASGLGEGAARALAASGCKVAILDLQKEQGRKVAEDIGGIFLECDVSS
PDSAEAAINAAREAHGPCGIAVNCAGIATASKILGREGVMPLENFSKVIQVNLIGTFNIL
RLAAADMAQREPNADGERGVIINTASVAAYEGQIGQAAYSASKGGVVSLTLQSARELARE
GIRVNTIAPGLFMTPMMAGMPEEVQESLAATLPFPKRLGKPEEFGMMVDQMVRNPILNGE
VIRLDCALRMAPK