Protein Info for PGA1_c10410 in Phaeobacter inhibens DSM 17395

Annotation: NADH-quinone oxidoreductase chain 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 TIGR01958: NADH-quinone oxidoreductase, E subunit" amino acids 23 to 169 (147 residues), 170.5 bits, see alignment E=1.3e-54 PF01257: 2Fe-2S_thioredx" amino acids 24 to 169 (146 residues), 169.5 bits, see alignment E=2.1e-54

Best Hits

KEGG orthology group: K00334, NADH dehydrogenase I subunit E [EC: 1.6.5.3] (inferred from 77% identity to sit:TM1040_0746)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain E (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DZ98 at UniProt or InterPro

Protein Sequence (397 amino acids)

>PGA1_c10410 NADH-quinone oxidoreductase chain 2 (Phaeobacter inhibens DSM 17395)
MLRRLHSEQPDSFAFTSENQTWAEAQITKFPDGRQASAIIPLLWRAQEQEGWLSKPAIEY
VADMLGMAYIRALEVASFYFMFQLQPTGSIAHVQICGTTSCMICGAEDLIAVCQDKIANQ
PFTLSADGKFTWEEVECLGACTNAPMAQIGKDYYEDLTAEGFAKLLDNLAAGQVPLPGPQ
NGRYAAEPKSGLTSLTEYESGKTQYNASVQLAADIGDTVKRIDGTEVPILTPWIGKDGKV
AGRDSADTPPPAPKTPLPAVKQAEVAKAKPAAPKKAAPKKAGVGEPASPEGAAAEAAAGV
EEKPETLTAARDGGADDLKMLKGVGPKLEQTLNDLGFFHFDQIAAWTDEQVAWVDSRLKF
KGRIVRDGWIEQSRQLAAGEETDFAKKAKADDRYKDD