Protein Info for PGA1_c10380 in Phaeobacter inhibens DSM 17395

Annotation: NADH-quinone oxidoreductase subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 174 TIGR01957: NADH-quinone oxidoreductase, B subunit" amino acids 27 to 168 (142 residues), 245.5 bits, see alignment E=7.7e-78 PF01058: Oxidored_q6" amino acids 53 to 162 (110 residues), 104.1 bits, see alignment E=2.3e-34

Best Hits

Swiss-Prot: 98% identical to NUOB_RUEST: NADH-quinone oxidoreductase subunit B (nuoB) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K00331, NADH dehydrogenase I subunit B [EC: 1.6.5.3] (inferred from 97% identity to sil:SPO2785)

MetaCyc: 58% identical to ferredoxin-menaquinone dehydrogenase subunit B (Helicobacter pylori 26695)
7.1.1.-

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain B (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DNZ3 at UniProt or InterPro

Protein Sequence (174 amino acids)

>PGA1_c10380 NADH-quinone oxidoreductase subunit B (Phaeobacter inhibens DSM 17395)
MTGANTAGVDKEVVTQALNAELQDKGFLLTSAEDIINWARTGSLHWMTFGLACCAVEMMH
TSMPRYDAERFGIAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCAN
GGGYYHYSYSVVRGCDRVVPVDVYVPGCPPTAEALLYGLMQLQRKIRRTGTLVR