Protein Info for PGA1_c10380 in Phaeobacter inhibens DSM 17395

Annotation: NADH-quinone oxidoreductase subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01957: NADH-quinone oxidoreductase, B subunit
  • amino acids 27 to 168 (142 residues), 245.5 bits, E=7.7e-78
• PF01058: Oxidored_q6
  • amino acids 53 to 162 (110 residues), 104.7 bits, E=1.5e-34

Best Hits

Swiss-Prot: 98% identical to NUOB_RUEST: NADH-quinone oxidoreductase subunit B (nuoB) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K00331, NADH dehydrogenase I subunit B [EC: 1.6.5.3] (inferred from 97% identity to sil:SPO2785)

MetaCyc: 58% identical to ferredoxin-menaquinone dehydrogenase subunit B (Helicobacter pylori 26695)
7.1.1.-

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain B (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• aerobic respiration III (alternative oxidase pathway) (3/3 steps found)
• aerobic respiration I (cytochrome c) (3/4 steps found)
• NADH to cytochrome bd oxidase electron transfer I (1/2 steps found)
• NADH to cytochrome bo oxidase electron transfer I (1/2 steps found)
• NAD(P)/NADPH interconversion (3/6 steps found)
• Fe(II) oxidation (2/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

See I7DNZ3 at UniProt or InterPro

Protein Sequence (174 amino acids)

>PGA1_c10380 NADH-quinone oxidoreductase subunit B (Phaeobacter inhibens DSM 17395)
MTGANTAGVDKEVVTQALNAELQDKGFLLTSAEDIINWARTGSLHWMTFGLACCAVEMMH
TSMPRYDAERFGIAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCAN
GGGYYHYSYSVVRGCDRVVPVDVYVPGCPPTAEALLYGLMQLQRKIRRTGTLVR