Protein Info for Psest_1050 in Pseudomonas stutzeri RCH2

Annotation: Paraquat-inducible protein B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 769 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details PF02470: MlaD" amino acids 41 to 133 (93 residues), 48.4 bits, see alignment E=4.5e-17 amino acids 158 to 221 (64 residues), 44.3 bits, see alignment E=8.7e-16 amino acids 285 to 371 (87 residues), 41 bits, see alignment E=9.2e-15 amino acids 396 to 457 (62 residues), 46.3 bits, see alignment 2e-16 amino acids 518 to 608 (91 residues), 46.8 bits, see alignment E=1.5e-16 amino acids 633 to 691 (59 residues), 36.2 bits, see alignment 3e-13

Best Hits

KEGG orthology group: K06192, paraquat-inducible protein B (inferred from 96% identity to psa:PST_3246)

Predicted SEED Role

"Paraquat-inducible protein B" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GIL1 at UniProt or InterPro

Protein Sequence (769 amino acids)

>Psest_1050 Paraquat-inducible protein B (Pseudomonas stutzeri RCH2)
MTDLPQANTRPASSWSAIWILPLIALMIGAWLAWQAYSERGIHIEVVFESAEGIEIGKTS
VLYKGMTIGVVRDLRLGDDERRQVVVADIEMNKDVDGYLRSGTRFWLVKPSVTLAGITGL
ETLVSGNYIGISPADGEPTKRFVALAEEPPMSDSRIGLHLTLKAERLGSLNRGSPVFYRQ
IQVGQVKNYVLAEDDSTVEVQLYIQPEYAHLVRKHTRFWNASGVTVDAGLTGVKFRTESL
ASIVAGGIAFATPAHRKDSPATDPSIPFRLYEDFDAAQAGIKTLVSLQDFDGLQAGRTPV
IYKGMQVGLLKKLDIDSDLSGAQAELSIDPLFEDYLVEDTQFWVVKPSVSVAGISGLEAL
VRGNYISVRPGEKGAEPRRNFVARAKAPPLDIRSPGLHLVLTADNLGSLDVGSPVLYRQV
RVGSVQSYQFSRDQQRVVVGVHIEQPYADLVNSSSRFWNASGISLTGGLSGIEVRSESLQ
SLLAGGIAFETPDPHASATRKVPRFELHKDRDSAIRRGTSIEIRLDRGDGLGAGTPIRYK
GLEVGEVDSVTLSDDIGHVVLQARITAAESRIARAGTQFWVVRPELGLMRTANLDTLISG
PYLEVAPGKPGAAAQARFVGQEREPQKAGEGLALVLSAARLGSIKPGNAVTYREVKVGEV
TGFELGQTADRVLIRVLIEPRYAALVHTGSRFWETSGFGVDFSLFKGASLRTDSLESLIE
GGVAFATPDGERMGQRALPGQTFALFKEPQEEWFDWAPKIELGQAASGR