Protein Info for PGA1_c10250 in Phaeobacter inhibens DSM 17395

Annotation: phosphoglycolate phosphatase-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 PF00702: Hydrolase" amino acids 1 to 181 (181 residues), 102.3 bits, see alignment E=9e-33 PF13419: HAD_2" amino acids 4 to 187 (184 residues), 106 bits, see alignment E=5.3e-34 PF12710: HAD" amino acids 4 to 175 (172 residues), 62.9 bits, see alignment E=1.2e-20 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 59 to 187 (129 residues), 34.1 bits, see alignment E=4.4e-12 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 91 to 181 (91 residues), 31.2 bits, see alignment E=3.9e-11 PF13242: Hydrolase_like" amino acids 143 to 210 (68 residues), 40.3 bits, see alignment E=4.7e-14

Best Hits

KEGG orthology group: K01091, phosphoglycolate phosphatase [EC: 3.1.3.18] (inferred from 72% identity to sil:SPO2796)

Predicted SEED Role

"Phosphoglycolate phosphatase (EC 3.1.3.18)" in subsystem 2-phosphoglycolate salvage or Glycolate, glyoxylate interconversions or Photorespiration (oxidative C2 cycle) (EC 3.1.3.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.18

Use Curated BLAST to search for 3.1.3.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EKL0 at UniProt or InterPro

Protein Sequence (221 amino acids)

>PGA1_c10250 phosphoglycolate phosphatase-like protein (Phaeobacter inhibens DSM 17395)
MRTVIFDLDGTLADTSGDLLAAANACFRKMGLGDLLHLPQDAGVALRGGKSMLTAGLKRA
GRYSEDLVEEYYPVLLEQYRDAIDHHTVMYPGAMEAVEQLKVDGFRVGICTNKPEALAEK
LTRSLGVRDAFHSLVGADTLPVRKPDPEPLREAARRAGGDPERTILIGDTDTDRKTSAAA
GVASVLVTFGPSGGDLEALRPEALLQRFEDLPALAARLLPL