Protein Info for Psest_1040 in Pseudomonas stutzeri RCH2

Annotation: Sulfite oxidase and related enzymes

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 PF00174: Oxidored_molyb" amino acids 112 to 269 (158 residues), 111.2 bits, see alignment E=2.2e-36

Best Hits

Swiss-Prot: 70% identical to MSRP_PSEAE: Protein-methionine-sulfoxide reductase catalytic subunit MsrP (msrP) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K07147, (no description) (inferred from 85% identity to psa:PST_3254)

Predicted SEED Role

"Putative sulfite oxidase subunit YedY"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GIK6 at UniProt or InterPro

Protein Sequence (335 amino acids)

>Psest_1040 Sulfite oxidase and related enzymes (Pseudomonas stutzeri RCH2)
MLIKFPASGECRESDVTPEAAYLSRRQVLRGAMLSGAMVGLPSLANAAARYSGVTAEPAS
AWFTGKLANARWQAVVAEGEPITPYADATSYNNFYEFGPDKGDPARHASALKVEPWTVLM
DGEVERPGRYSLEDLCSEAQLEERIYRLRCVEAWSMVIPWLGFPLADLVRRVQPHSSAKF
IRFETAYRPEEMRGTRSGFALIDWPYVEGLRMDEAMHPLTLLAVGMYGRTLPNQNGAPLR
LVVPWKYGFKSIKSIVRISFVREQPATTWQSMAPEEYGFYANVNPKVSHPRWSQARERRL
PGSLFNANVQETLLFNGYAEQVAGLYSSMDLGKDY