Protein Info for PGA1_c10200 in Phaeobacter inhibens DSM 17395

Annotation: molybdenum cofactor biosynthesis protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 TIGR02666: molybdenum cofactor biosynthesis protein A" amino acids 5 to 335 (331 residues), 364.1 bits, see alignment E=3.1e-113 PF04055: Radical_SAM" amino acids 18 to 180 (163 residues), 109.6 bits, see alignment E=2.9e-35 PF13353: Fer4_12" amino acids 22 to 126 (105 residues), 31.5 bits, see alignment E=3e-11 PF06463: Mob_synth_C" amino acids 186 to 314 (129 residues), 125.2 bits, see alignment E=2.5e-40

Best Hits

Swiss-Prot: 84% identical to MOAA_DINSH: GTP 3',8-cyclase (moaA) from Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)

KEGG orthology group: K03639, molybdenum cofactor biosynthesis protein (inferred from 90% identity to sit:TM1040_0724)

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EKK6 at UniProt or InterPro

Protein Sequence (335 amino acids)

>PGA1_c10200 molybdenum cofactor biosynthesis protein A (Phaeobacter inhibens DSM 17395)
MTAPLIDPFARAITYLRVSVTDRCDFRCVYCMSENMTFLPKKELLTLEELDRMCSTFVNL
GVEKLRITGGEPLVRRGIMTFFRSMTRHLESGALKELTLTTNGSQLEKYAQDLYDAGVRR
VNVSLDTIDEDKFAEITRWGRLPQVLRGIDAAQKAGLRIKINAVALKGFNEDELPAITRW
CAERDMDLTWIEVMPMGDIGNENRLGQYWSLKDVRRAYDDHYSVTDLAERTGGPARYVRL
EETGQKIGFITPLSHNFCESCNRVRLTCTGELYMCLGQEDMADLRGPLRDHPGNDQALEN
AIRAAITLKPKGHDFDYSRQKLDGQMPRHMSHTGG