Protein Info for HP15_10 in Marinobacter adhaerens HP15

Annotation: transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 845 transmembrane" amino acids 37 to 55 (19 residues), see Phobius details amino acids 243 to 264 (22 residues), see Phobius details amino acids 272 to 292 (21 residues), see Phobius details amino acids 299 to 316 (18 residues), see Phobius details amino acids 343 to 366 (24 residues), see Phobius details amino acids 376 to 398 (23 residues), see Phobius details amino acids 437 to 457 (21 residues), see Phobius details amino acids 645 to 664 (20 residues), see Phobius details amino acids 675 to 697 (23 residues), see Phobius details amino acids 704 to 728 (25 residues), see Phobius details amino acids 749 to 767 (19 residues), see Phobius details amino acids 777 to 802 (26 residues), see Phobius details PF03176: MMPL" amino acids 220 to 411 (192 residues), 29.5 bits, see alignment E=1.9e-11 amino acids 628 to 799 (172 residues), 31.1 bits, see alignment E=6.4e-12

Best Hits

KEGG orthology group: K07003, (no description) (inferred from 68% identity to gag:Glaag_0398)

Predicted SEED Role

"FIG005548: transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PHI6 at UniProt or InterPro

Protein Sequence (845 amino acids)

>HP15_10 transporter (Marinobacter adhaerens HP15)
MVNQKAHTGMPVVPNLEDFDKRSGGAFERLIFSHRKLVLFSCLFMTLVMGFFAAKLDVNA
SFERMIPVNNPYIQNYLQYKSELPGLGNTIRVVVSNKQGDIYDPEYLKTLEEVNDTLYLI
PGIDRSWMRSLWMPIVRWREVTENGITGGAVMPSDYDGTESSIQSLKRNVDRAGLRGSLV
ASDESSSMIVAPLLDRNPNTGEPLDYGEFSQELENKIRSYESEKIGIHIVGFSKLVGDLI
DGLQAVMLFFAVSVVIAALFVYLYTRCLRSTILLVSIAVIGVVWLLGLMQILGYSLDPYS
ILVPFLIFAIGLSHGTQKMNGVLQDIGRGTHKYVAARYTFRRLFLTGLTALLTNIVGFAV
LAIIDIPVIRDLAITTSIGVFLLIFTKLILIPVSLSYIGVSKKAARIAIEKEKSDSQSST
WLGRVWAGLDKFTDRKFAIGAIFASVLITAISSVIMMDLKIGDLDPGAPELRPDSRYNLD
NAYINENYGLSSDQFAVIMKTDPDGCRFYEPLKAMDKLAWQLRQTSGVQATDSLAERVRL
MTSGMAEGSTKWFTISRDQAITNAAVDAAMISSPGVTNQDCSVTPLIAYLTDHKADTLTR
VLNEVQGFAAENNTSQDAERPVEFLLAAGNAGIEAATNIEVRKGIVIMYFAVYGATALLC
LLTFRSFGRAIRATVVAMVPLIMTTIICKALMVGLGIGLKVATLPVIAVGVGVGVDYALY
LLGVQVAVQARGESLTVAYRRSLDFTGRVVALIGLTMAAGVVTWAWSPIKFQADMGILLT
FMFLWNMIGALILIPALSHFLLNDSENLKPESGSVGASDSPGAADTSSQSHQKAVTQTSR
MVVAD