Protein Info for EX31_RS25360 in Rahnella sp. WP5

Annotation: translation initiation factor IF-3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 183 PF05198: IF3_N" amino acids 15 to 84 (70 residues), 117 bits, see alignment E=3.4e-38 TIGR00168: translation initiation factor IF-3" amino acids 15 to 182 (168 residues), 246.8 bits, see alignment E=4.1e-78 PF00707: IF3_C" amino acids 91 to 180 (90 residues), 114.9 bits, see alignment E=1.3e-37

Best Hits

Swiss-Prot: 98% identical to IF3_YERPS: Translation initiation factor IF-3 (infC) from Yersinia pseudotuberculosis serotype I (strain IP32953)

KEGG orthology group: K02520, translation initiation factor IF-3 (inferred from 100% identity to rah:Rahaq_2835)

Predicted SEED Role

"Translation initiation factor 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (183 amino acids)

>EX31_RS25360 translation initiation factor IF-3 (Rahnella sp. WP5)
MKGGKRVQPARPNRINKEIRAQEVRLTGVDGEQIGIVSLNEALEKAEEAGVDLVEISPNA
EPPVCRIMDYGKFLYEKSKSTKEQKKKQKVIQVKEIKFRPGTDDGDYQVKLRNLIRFLED
GDKAKITLRFRGREMAHQQIGMEVLNRVRKDLCEDSELAVVESFPTKIEGRQMIMVLAPK
KKQ