Protein Info for EX31_RS24885 in Rahnella sp. WP5

Annotation: protease HtpX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 33 to 53 (21 residues), see Phobius details amino acids 154 to 174 (21 residues), see Phobius details amino acids 193 to 217 (25 residues), see Phobius details PF01435: Peptidase_M48" amino acids 74 to 288 (215 residues), 134.5 bits, see alignment E=2.1e-43

Best Hits

Swiss-Prot: 93% identical to HTPX_PECAS: Protease HtpX (htpX) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K03799, heat shock protein HtpX [EC: 3.4.24.-] (inferred from 100% identity to rah:Rahaq_2848)

Predicted SEED Role

"Probable protease HtpX (EC 3.4.24.-)" (EC 3.4.24.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (293 amino acids)

>EX31_RS24885 protease HtpX (Rahnella sp. WP5)
MMRIALFLLTNLAVMLVFGLVLSLTGIQHSSVPGLMIMAGLFGFGGAIVSLLMSKWMALR
SVGGEVIEQPRNETERWLMDTVRRQSQQAGIAMPQVAIYHAPDINAFATGARRDASLVAV
STGLLQSMSQDEAEAVIAHEISHIANGDMVTMTLIQGIVNTFVIFISRIIAQVASGFLSG
NRDGEESSNGNPLIYFAVATVLELVFGILASIITMWFSRHREFHADAGSAKLVGREKMIA
ALQRLKTSHEPQEAGSMMAFCINGKSKSFSELFMSHPPLDKRIEALRSGAYIK