Protein Info for EX31_RS24875 in Rahnella sp. WP5

Annotation: RNA chaperone ProQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 PF04352: ProQ" amino acids 8 to 115 (108 residues), 135.7 bits, see alignment E=6.2e-44 PF17516: ProQ_C" amino acids 179 to 228 (50 residues), 83.3 bits, see alignment E=6.1e-28

Best Hits

Swiss-Prot: 86% identical to PROQ_YERPA: RNA chaperone ProQ (proQ) from Yersinia pestis bv. Antiqua (strain Antiqua)

KEGG orthology group: K03607, ProP effector (inferred from 100% identity to rah:Rahaq_2851)

Predicted SEED Role

"ProQ: influences osmotic activation of compatible solute ProP" in subsystem Proline, 4-hydroxyproline uptake and utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (229 amino acids)

>EX31_RS24875 RNA chaperone ProQ (Rahnella sp. WP5)
MENQPKLNSSKEVIAFLAERFPLCFTAEGEARPLKIGIFADLVARVQGEENLSKTQLRSA
LRLYTSSWRYLYGVKVGAERVDLDGNSCGVLEEQHVEHARKQLEEAKARVQAQRAEQQAK
RREAGETAEPRRPRPAAKKPAPRRENAPAAVAGQENRKPRTPRPPREEKREPRHVPVTDI
SKLQIGQEIKVRAGQSAMDATVLEIAKDGVRVQLSSGLAMIVRAEHLQF