Protein Info for EX31_RS24800 in Rahnella sp. WP5

Annotation: MBL fold metallo-hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 659 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF00753: Lactamase_B" amino acids 130 to 225 (96 residues), 65.5 bits, see alignment E=1.3e-21 PF14863: Alkyl_sulf_dimr" amino acids 389 to 527 (139 residues), 212 bits, see alignment E=8.5e-67 PF14864: Alkyl_sulf_C" amino acids 535 to 659 (125 residues), 137.3 bits, see alignment E=6.8e-44 PF02036: SCP2" amino acids 561 to 639 (79 residues), 24.8 bits, see alignment E=4.7e-09

Best Hits

KEGG orthology group: None (inferred from 90% identity to spe:Spro_3112)

Predicted SEED Role

"Putative hydrolase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (659 amino acids)

>EX31_RS24800 MBL fold metallo-hydrolase (Rahnella sp. WP5)
MKLKLIVKSLALAGLLSSTSLTPLFAQEAPKDATAATKQANDALYNQLPFSDNTDFTNAH
KGFIAAIPAEVIKGTQGNIVWDPQKYAFIKEGDKAPESVNPSLWRQSQLINISGLFEVTD
GVYQIRNIDLSNMTIIEGKEGITVVDPLVSAETAKVGMDLYYKNRGQKPVVAVIYTHSHV
DHYGGVRGVVDEADVKSGKVKIYAPAGFMDEAVSENIMAGNVMSRRASYMYGNLLKPDAK
GQVGAGLGTTTSAGTVTLIAPTNYITKTGQKETIDGLTYDFMMAPGSEAPSEMLWYIEEK
KLIEAAEDVTHTLHNTYSLRGAKIRDPLAWSKYINDAINRWGDKAEIIMAQHHWPTWGKD
NVVSLMKSQRDMYRYINDQTLRLANTGLTRDEIAANFKLPDGLAKTWASRGYYGSVSHDV
KATYVLYLGWFDGNPATLDELPPEEAAKKFVDYMGGADNILKKAKEDYDQGNYRWVAQVV
SKVVFADPKNEAARNLEADALEQLGYQAESGPWRNFYLTGAQELRNGVQKLPTPNTASPD
TVKAMSPEMFFDYLGVHINGEKAANAKAVFNVDLGSDGGKYKLELENGVLNHTADAEAKD
ADATIVLNRDTLNKIILKEVTLKQAEDKGDVKVTGNGAKLDEMLGYMDKFEFWFNIVTP