Protein Info for EX31_RS24790 in Rahnella sp. WP5

Annotation: cation transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 48 to 69 (22 residues), see Phobius details amino acids 82 to 104 (23 residues), see Phobius details amino acids 116 to 138 (23 residues), see Phobius details amino acids 158 to 177 (20 residues), see Phobius details amino acids 183 to 201 (19 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 13 to 292 (280 residues), 227.3 bits, see alignment E=1.2e-71 PF01545: Cation_efflux" amino acids 16 to 209 (194 residues), 142.1 bits, see alignment E=2e-45 PF16916: ZT_dimer" amino acids 214 to 290 (77 residues), 74.9 bits, see alignment E=4.5e-25

Best Hits

Swiss-Prot: 54% identical to Y1263_SYNY3: Uncharacterized transporter sll1263 (sll1263) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: None (inferred from 100% identity to rah:Rahaq_2868)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (303 amino acids)

>EX31_RS24790 cation transporter (Rahnella sp. WP5)
MSKNKALTPSLTRYAWLSIATAIATIGLKGVAWKMTGSVGLLSDAIESVVNLAGALTALW
MLTLAALPADDKHAYGHGKAEYFSSAFEGFLILLAAASIAYTAVDRMLAPQPLDAVGVGL
LVSVVASVLNFVTARILLRAGKQHNSITLEADAHHLLTDVWTSVGVILGVGLVYLTGWLW
VDPVIALLVAANIVWTGYQLMSRSAAGLMDVSLPVEELEKIESLLAGYREQGLDFHALRT
RQAGGRAFMTLHILVPGLWTVQHGHDWAERIENDIRTALPFIHITTHVEPLEDPASMNDQ
ALD