Protein Info for EX31_RS24775 in Rahnella sp. WP5

Annotation: copper homeostasis membrane protein CopD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 transmembrane" amino acids 15 to 40 (26 residues), see Phobius details amino acids 48 to 71 (24 residues), see Phobius details amino acids 94 to 113 (20 residues), see Phobius details amino acids 120 to 140 (21 residues), see Phobius details amino acids 156 to 177 (22 residues), see Phobius details amino acids 195 to 219 (25 residues), see Phobius details amino acids 225 to 247 (23 residues), see Phobius details amino acids 267 to 291 (25 residues), see Phobius details PF05425: CopD" amino acids 188 to 287 (100 residues), 69.7 bits, see alignment E=1.3e-23

Best Hits

KEGG orthology group: K07245, putative copper resistance protein D (inferred from 100% identity to rah:Rahaq_2882)

Predicted SEED Role

"Copper resistance protein D" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (294 amino acids)

>EX31_RS24775 copper homeostasis membrane protein CopD (Rahnella sp. WP5)
MSLTALFVLCRFMHFASLMQIFGLSVFCSLLTPAGFSAVLLRKNQTLMICSALVAAVTSV
GMLAIQAALMGNGWSDALNLNVWLLVLTTAFGEVWRWHLLLTAALLLVLLMDWLPARNML
VFLCSCGLLMSQALVGHAAMHEGLPGLVQRTNHVVHLLSAAYWFGCLLPLLICMGYTRQP
SARPYAIATLIRFSLWGHAAVALVILTGIINTAIILQRWPTDMTSLYQCLLVVKVIMVGM
MVAVAVFNRYRLVPLMGKEPDRAQHYFIMMTWLEWGLALGVLLLVSVFATLAPR