Protein Info for EX31_RS24720 in Rahnella sp. WP5

Annotation: CoA pyrophosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 PF00293: NUDIX" amino acids 40 to 157 (118 residues), 57 bits, see alignment E=1.1e-19

Best Hits

Swiss-Prot: 67% identical to NUDL_YERE8: Uncharacterized Nudix hydrolase NudL (nudL) from Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)

KEGG orthology group: None (inferred from 100% identity to rah:Rahaq_2894)

MetaCyc: 67% identical to putative NUDIX hydrolase with low 3-phosphohydroxypyruvate phosphatase activity (Escherichia coli K-12 substr. MG1655)
RXN0-6562

Predicted SEED Role

"Hypothetical nudix hydrolase YeaB" in subsystem Nudix proteins (nucleoside triphosphate hydrolases)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (200 amino acids)

>EX31_RS24720 CoA pyrophosphatase (Rahnella sp. WP5)
MTLLEQHAPLQTFSPAVEDFILRFQLQQPRLPAAALRGTRHAAVLIPIICRPEPTLLLTR
RSDQLRKHAGQVAFPGGAADASDASIIATALREAHEEVAIPPEQVHILGTLSPQDSSSGF
QVTPVIGLLPVDVPLHPAEDEVAELFEMPLREAFDLARYHPLDIHRRGTHHRVYLSWYQQ
QFVWGLTAGIIRQLARQVEV