Protein Info for EX31_RS24360 in Rahnella sp. WP5

Annotation: AI-2E family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 transmembrane" amino acids 9 to 27 (19 residues), see Phobius details amino acids 33 to 54 (22 residues), see Phobius details amino acids 62 to 85 (24 residues), see Phobius details amino acids 142 to 163 (22 residues), see Phobius details amino acids 197 to 219 (23 residues), see Phobius details amino acids 222 to 250 (29 residues), see Phobius details amino acids 253 to 255 (3 residues), see Phobius details amino acids 261 to 279 (19 residues), see Phobius details amino acids 291 to 318 (28 residues), see Phobius details PF01594: AI-2E_transport" amino acids 15 to 326 (312 residues), 234.4 bits, see alignment E=1e-73

Best Hits

Swiss-Prot: 61% identical to TQSA_ECOLI: AI-2 transport protein TqsA (tqsA) from Escherichia coli (strain K12)

KEGG orthology group: K11744, AI-2 transport protein TqsA (inferred from 100% identity to rah:Rahaq_2972)

MetaCyc: 61% identical to autoinducer 2 exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-453

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (347 amino acids)

>EX31_RS24360 AI-2E family transporter (Rahnella sp. WP5)
MRKTIVTTQGLKIVVMMAMLVVIFAGIKSAADIIVPFILALFLAFVLNPLIVLLEKWRVP
RALAVLLVATLVICMMVFLTTKLLVTLNEFARTLPQYRGLIVDKLSDIEAWFPQSELTLS
PEQLASYIDPAATLNMVSKLISYLSNAMAGLFLLLMTVAFMLLEVPQLPYKVEQMSEDPG
KGMANIQRALDSVTRYLVIKTLISVVTGLAVWALLAVTGIRFAFLWGMLAFALNYIPNIG
SFIAAIPPIIQAFLFNGFSEGLILAGGYILINLIFGSIIDPKILGRGLGLSTLVVFMSLI
FWGWLMGPVGMLLSVPLTIVLKIALEPTAAGHKIAVLLGDGPPEHKS