Protein Info for EX31_RS24185 in Rahnella sp. WP5

Annotation: DNA-binding transcriptional repressor DeoR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 PF08220: HTH_DeoR" amino acids 8 to 59 (52 residues), 37.8 bits, see alignment E=1.3e-13 PF00455: DeoRC" amino acids 77 to 234 (158 residues), 155.8 bits, see alignment E=9.6e-50

Best Hits

Swiss-Prot: 53% identical to DEOR_ECO57: Deoxyribose operon repressor (deoR) from Escherichia coli O157:H7

KEGG orthology group: K11534, DeoR family transcriptional regulator, deoxyribose operon repressor (inferred from 99% identity to rah:Rahaq_3001)

Predicted SEED Role

"Deoxyribose operon repressor, DeoR family" in subsystem Deoxyribose and Deoxynucleoside Catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (254 amino acids)

>EX31_RS24185 DNA-binding transcriptional repressor DeoR (Rahnella sp. WP5)
MENKREDRIQRLLLALKKTDKIHLKEASLLLNVSEMTVRRDLSAAPAPVILLGGYIVIDP
KNNPATHYFISEQKTRHVAEKQRLAARAASLIQDNDTVFFDCGTTMPYVIESIADNRVFT
AICYSLNTFLALQEKPQCEVILCGGAFKSSNSIFTPIGRSSELDFIRPAKAFISAAGVSI
EHGVTCFNFDELLMKHQAIERSAQSILVADSSKFDQVRPAAIAPLARFNVVVSDAEPPQA
YVDFCELSDIPLLV