Protein Info for EX31_RS24150 in Rahnella sp. WP5

Annotation: excinuclease ABC subunit UvrC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 618 TIGR00194: excinuclease ABC subunit C" amino acids 17 to 597 (581 residues), 751.4 bits, see alignment E=3.6e-230 PF01541: GIY-YIG" amino acids 26 to 101 (76 residues), 42.7 bits, see alignment E=1.5e-14 PF02151: UVR" amino acids 213 to 245 (33 residues), 34.6 bits, see alignment (E = 3e-12) PF08459: UvrC_RNaseH_dom" amino acids 393 to 550 (158 residues), 159.4 bits, see alignment E=1.6e-50 PF14520: HHH_5" amino acids 565 to 617 (53 residues), 33.9 bits, see alignment 8.6e-12

Best Hits

Swiss-Prot: 90% identical to UVRC_SERP5: UvrABC system protein C (uvrC) from Serratia proteamaculans (strain 568)

KEGG orthology group: K03703, excinuclease ABC subunit C (inferred from 100% identity to rah:Rahaq_3005)

MetaCyc: 82% identical to UvrABC excision nuclease subunit C (Escherichia coli K-12 substr. MG1655)
3.1.25.-

Predicted SEED Role

"Excinuclease ABC subunit C" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (618 amino acids)

>EX31_RS24150 excinuclease ABC subunit UvrC (Rahnella sp. WP5)
MRRLYPAVSDERFDPKAFLKTVTSQPGVYRMYDASGTVIYVGKAKDLKKRLSSYFRVQVS
SRKTETLVKNIAQIDVTVTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPQIFLSADNH
PRLSVHRGAKHAKGEYFGPFPNSYAVRETLALLQKLFPIRQCENSVYSNRSRPCLQYQIG
RCLGPCVKGLVSEEDYKDQVEYVRLFLSGKDQQVVTQLVNRMEEASKALRFEDAGRIRDQ
IQAVRRVTERQFVSGNSEDLDVIGVGFESGMACLHVLFIRQGKVLGSRSYFPKVPGGTDL
GEVVQTFVGQFYLQGSQQRTLPGEILLDFSLAEKDLLADSLSELAGRKVQIQSKPRGDRA
RYLKLARTNASAALTTKLAQQSTIHQRLSELAKTLNLAEINRMECFDISHTMGEQTVASC
VVFDGNGPVRSEYRRYNITGITPGDDYAAMAQVLQRRYGKTLDDNKIPDVIFIDGGKGQL
GMALDVFHSLNVEWDKSKPLLIGIAKGADRKAGLETLFFVPEGEGIALPADSPALHVIQH
IRDDSHNHAITGHRQRRAKVRTTSALEEIEGVGPKRRQVLLKYMGGIQPLLNASVEEIAQ
VPGISIALAEKIHNALKH